-
- Target Alle Catenin Produkte
- Catenin
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Catenin Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- Catenin antibody was raised using a synthetic peptide corresponding to a region with amino acids QTIWGYKELRKPLEKEGWKKSDFQVNLNNASRSQSSHSYDDSTLPLIDRN
-
anti-Catenin antibody
Reaktivität: Human, Maus, Ratte WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Catenin Blocking Peptide, catalog no. 33R-7753, is also available for use as a blocking control in assays to test for specificity of this Catenin antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CTNND1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Catenin
- Abstract
- Catenin Produkte
- Synonyme
- Bfc antikoerper, Catnb antikoerper, Mesc antikoerper, CTNNB antikoerper, MRD19 antikoerper, armadillo antikoerper, catenin (cadherin associated protein), beta 1 antikoerper, catenin beta 1 antikoerper, Ctnnb1 antikoerper, CTNNB1 antikoerper
- Hintergrund
- This gene encodes a member of the Armadillo protein family, which function in adhesion between cells and signal transduction. Multiple translation initiation codons and althernative splicing result in many different isoforms being translated. Not all of the full-length natures of the described transcript variants have been determined.
- Molekulargewicht
- 108 kDa (MW of target protein)
-
Sie sind hier:
