ACAA2 Antikörper (N-Term)

Produktnummer ABIN631066

Produktdetails anti-ACAA2 Antikörper

Target: ACAA2 (Acetyl-CoA Acyltransferase 2 (ACAA2))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ACAA2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ACAA2 antibody was raised against the N terminal of ACAA2

Aufreinigung: Affinity purified

Immunogen: ACAA2 antibody was raised using the N terminal of ACAA2 corresponding to a region with amino acids ALLRGVFVVAAKRTPFGAYGGLLKDFTATDLSEFAAKAALSAGKVSPETV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ACAA2 Blocking Peptide, catalog no. 33R-1355, is also available for use as a blocking control in assays to test for specificity of this ACAA2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACAA2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ACAA2

Target: ACAA2 (Acetyl-CoA Acyltransferase 2 (ACAA2))

Andere Bezeichnung: ACAA2 (ACAA2 Produkte)

Synonyme: DSAEC antikoerper, fb59b11 antikoerper, zgc:56036 antikoerper, wu:fb59b11 antikoerper, 0610011L04Rik antikoerper, AI255831 antikoerper, AI265397 antikoerper, D18Ertd240e antikoerper, acetyl-CoA acyltransferase 2 antikoerper, acetyl-Coenzyme A acyltransferase 2 (mitochondrial 3-oxoacyl-Coenzyme A thiolase) antikoerper, acetyl-CoA acyltransferase 2 L homeolog antikoerper, ACAA2 antikoerper, Acaa2 antikoerper, acaa2 antikoerper, acaa2.L antikoerper

Hintergrund: ACAA2 catalyzes the last step of the mitochondrial fatty acid beta-oxidation spiral. Unlike most mitochondrial matrix proteins, it contains a non-cleavable amino-terminal targeting signal.

Molekulargewicht: 42 kDa (MW of target protein)

Pathways: Monocarboxylic Acid Catabolic Process