Catenin Antikörper

Produktnummer ABIN631067

Produktdetails anti-Catenin Antikörper

Target: Catenin

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Catenin Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: Catenin antibody was raised using a synthetic peptide corresponding to a region with amino acids YPPDGYSRHYEDGYPGGSDNYGSLSRVTRIEERYRPSMEGYRAPSRQDVY

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Catenin Blocking Peptide, catalog no. 33R-10205, is also available for use as a blocking control in assays to test for specificity of this Catenin antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CTNND1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Catenin

Target: Catenin

Abstract: Catenin Produkte

Synonyme: Bfc antikoerper, Catnb antikoerper, Mesc antikoerper, CTNNB antikoerper, MRD19 antikoerper, armadillo antikoerper, catenin (cadherin associated protein), beta 1 antikoerper, catenin beta 1 antikoerper, Ctnnb1 antikoerper, CTNNB1 antikoerper

Hintergrund: This gene encodes a member of the Armadillo protein family, which function in adhesion between cells and signal transduction. Multiple translation initiation codons and althernative splicing result in many different isoforms being translated.

Molekulargewicht: 93 kDa (MW of target protein)