MTRF1L Antikörper (N-Term)

Produktnummer ABIN631071

Produktdetails anti-MTRF1L Antikörper

Target: MTRF1L (Mitochondrial Translational Release Factor 1-Like (MTRF1L))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MTRF1L Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: MTRF1 L antibody was raised against the N terminal of MTRF1

Aufreinigung: Affinity purified

Immunogen: MTRF1 L antibody was raised using the N terminal of MTRF1 corresponding to a region with amino acids ELFTRGGPLRTFLERQAGSEAHLKVRRPELLAVIKLLNEKERELRETEHL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MTRF1L Blocking Peptide, catalog no. 33R-2544, is also available for use as a blocking control in assays to test for specificity of this MTRF1L antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MTRF0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MTRF1L

Target: MTRF1L (Mitochondrial Translational Release Factor 1-Like (MTRF1L))

Andere Bezeichnung: MTRF1L (MTRF1L Produkte)

Synonyme: fj59e12 antikoerper, wu:fj59e12 antikoerper, si:dkeyp-9b4.2 antikoerper, HMRF1L antikoerper, MRF1L antikoerper, mtRF1a antikoerper, 9130004K12Rik antikoerper, mitochondrial translational release factor 1 like antikoerper, mitochondrial translational release factor 1-like antikoerper, MTRF1L antikoerper, mtrf1l antikoerper, Mtrf1l antikoerper

Hintergrund: MTRF1L is a mitochondrial peptide chain release factor that directs the termination of translation in response to the peptide chain termination codons UAA and UAG.

Molekulargewicht: 30 kDa (MW of target protein)