DBT Antikörper (N-Term)
-
- Target Alle DBT Antikörper anzeigen
- DBT (Dihydrolipoamide Branched Chain Transacylase E2 (DBT))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser DBT Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- DBT antibody was raised against the N terminal of DBT
- Aufreinigung
- Affinity purified
- Immunogen
- DBT antibody was raised using the N terminal of DBT corresponding to a region with amino acids NYVCFFGYPSFKYSHPHHFLKTTAALRGQVVQFKLSDIGEGIREVTVKEW
- Top Product
- Discover our top product DBT Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
DBT Blocking Peptide, catalog no. 33R-6946, is also available for use as a blocking control in assays to test for specificity of this DBT antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DBT antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DBT (Dihydrolipoamide Branched Chain Transacylase E2 (DBT))
- Andere Bezeichnung
- DBT (DBT Produkte)
- Substanzklasse
- Viral Protein
- Hintergrund
- The branched-chain alpha-keto dehydrogenase complex catalyzes the overall conversion of alpha-keto acids to acyl-CoA and CO2. It contains multiple copies of three enzymatic components: branched-chain alpha-keto acid decarboxylase (E1), lipoamide acyltransferase (E2) and lipoamide dehydrogenase (E3).
- Molekulargewicht
- 46 kDa (MW of target protein)
-