DBT Antikörper (N-Term)

Produktnummer ABIN631072

Produktdetails anti-DBT Antikörper

Target: DBT (Dihydrolipoamide Branched Chain Transacylase E2 (DBT))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DBT Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: DBT antibody was raised against the N terminal of DBT

Aufreinigung: Affinity purified

Immunogen: DBT antibody was raised using the N terminal of DBT corresponding to a region with amino acids NYVCFFGYPSFKYSHPHHFLKTTAALRGQVVQFKLSDIGEGIREVTVKEW

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DBT Blocking Peptide, catalog no. 33R-6946, is also available for use as a blocking control in assays to test for specificity of this DBT antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DBT antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DBT

Target: DBT (Dihydrolipoamide Branched Chain Transacylase E2 (DBT))

Andere Bezeichnung: DBT (DBT Produkte)

Synonyme: BCATE2 antikoerper, BCKAD-E2 antikoerper, BCKADE2 antikoerper, E2 antikoerper, E2B antikoerper, D3Wsu60e antikoerper, im:7147214 antikoerper, zgc:103768 antikoerper, E2b antikoerper, dihydrolipoamide branched chain transacylase E2 antikoerper, hypothetical protein antikoerper, dihydrolipoamide branched chain transacylase E2 L homeolog antikoerper, DBT antikoerper, dbt antikoerper, CpipJ_CPIJ006326 antikoerper, BDBG_05874 antikoerper, NAEGRDRAFT_78509 antikoerper, VDBG_04820 antikoerper, PGTG_17722 antikoerper, Dbt antikoerper, dbt.L antikoerper

Substanzklasse: Viral Protein

Hintergrund: The branched-chain alpha-keto dehydrogenase complex catalyzes the overall conversion of alpha-keto acids to acyl-CoA and CO2. It contains multiple copies of three enzymatic components: branched-chain alpha-keto acid decarboxylase (E1), lipoamide acyltransferase (E2) and lipoamide dehydrogenase (E3).

Molekulargewicht: 46 kDa (MW of target protein)