FBXO31 Antikörper (Middle Region)
-
- Target Alle FBXO31 Antikörper anzeigen
- FBXO31 (F-Box Protein 31 (FBXO31))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser FBXO31 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- FBXO31 antibody was raised against the middle region of FBXO31
- Aufreinigung
- Affinity purified
- Immunogen
- FBXO31 antibody was raised using the middle region of FBXO31 corresponding to a region with amino acids VAAAEQPAQCGQGQPFVLPVGVSSRNEDYPRTCRMCFYGTGLIAGHGFTS
- Top Product
- Discover our top product FBXO31 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
FBXO31 Blocking Peptide, catalog no. 33R-9406, is also available for use as a blocking control in assays to test for specificity of this FBXO31 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXO31 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FBXO31 (F-Box Protein 31 (FBXO31))
- Andere Bezeichnung
- FBXO31 (FBXO31 Produkte)
- Synonyme
- 1110003O08Rik antikoerper, 2310046N15Rik antikoerper, Fbx14 antikoerper, Fbxo14 antikoerper, FBX14 antikoerper, FBXO14 antikoerper, Fbx31 antikoerper, pp2386 antikoerper, RGD1561069 antikoerper, fbx14 antikoerper, fbx31 antikoerper, fbxo14 antikoerper, fbxo31 antikoerper, F-box protein 31 antikoerper, F-box protein 31 S homeolog antikoerper, F-box protein 31 L homeolog antikoerper, Fbxo31 antikoerper, FBXO31 antikoerper, fbxo31 antikoerper, fbxo31.S antikoerper, fbxo31.L antikoerper
- Hintergrund
- FBXO31 is the component of some SCF (SKP1-cullin-F-box) protein ligase complex that plays a central role in G1 arrest following DNA damage. FBXO31 specifically recognises phosphorylated cyclin-D1 (CCND1), promoting its ubiquitination and degradation by the proteasome, resulting in G1 arrest.
- Molekulargewicht
- 40 kDa (MW of target protein)
-