NDUFA9 Antikörper
-
- Target Alle NDUFA9 Antikörper anzeigen
- NDUFA9 (NADH Dehydrogenase (Ubiquinone) 1 alpha Subcomplex, 9, 39kDa (NDUFA9))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser NDUFA9 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- NDUFA9 antibody was raised using a synthetic peptide corresponding to a region with amino acids QLHHALMPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIIPY
- Top Product
- Discover our top product NDUFA9 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
NDUFA9 Blocking Peptide, catalog no. 33R-7627, is also available for use as a blocking control in assays to test for specificity of this NDUFA9 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NDUFA9 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NDUFA9 (NADH Dehydrogenase (Ubiquinone) 1 alpha Subcomplex, 9, 39kDa (NDUFA9))
- Andere Bezeichnung
- NDUFA9 (NDUFA9 Produkte)
- Synonyme
- ndufs2l antikoerper, wu:fc41f12 antikoerper, zgc:112513 antikoerper, GB10406 antikoerper, NDUFA9 antikoerper, DDBDRAFT_0203708 antikoerper, DDBDRAFT_0302549 antikoerper, DDB_0203708 antikoerper, DDB_0302549 antikoerper, 1010001N11Rik antikoerper, CC6 antikoerper, CI-39k antikoerper, CI39k antikoerper, NDUFS2L antikoerper, SDR22E1 antikoerper, NADH:ubiquinone oxidoreductase subunit A9 antikoerper, NADH:ubiquinone oxidoreductase subunit A9 L homeolog antikoerper, NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9a antikoerper, NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial antikoerper, NADH dehydrogenase (ubiquinone) 1 alpha subcomplex 9 antikoerper, NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, 39kDa antikoerper, NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9 antikoerper, NDUFA9 antikoerper, ndufa9.L antikoerper, ndufa9 antikoerper, ndufa9a antikoerper, LOC551866 antikoerper, Ndufa9 antikoerper
- Hintergrund
- The encoded protein is a subunit of the hydrophobic protein fraction of the NADH:ubiquinone oxidoreductase (complex I), the first enzyme complex in the electron transport chain located in the inner mitochondrial membrane.
- Molekulargewicht
- 42 kDa (MW of target protein)
-