PCCA Antikörper (N-Term)

Produktnummer ABIN631082

Produktdetails anti-PCCA Antikörper

Target: PCCA (Propionyl CoA Carboxylase, alpha Polypeptide (PCCA))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PCCA Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PCCA antibody was raised against the N terminal of PCCA

Aufreinigung: Affinity purified

Immunogen: PCCA antibody was raised using the N terminal of PCCA corresponding to a region with amino acids LYYSRQCLMVSRNLGSVGYDPNEKTFDKILVANRGEIACRVIRTCKKMGI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PCCA Blocking Peptide, catalog no. 33R-5579, is also available for use as a blocking control in assays to test for specificity of this PCCA antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCCA antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PCCA

Target: PCCA (Propionyl CoA Carboxylase, alpha Polypeptide (PCCA))

Andere Bezeichnung: PCCA (PCCA Produkte)

Synonyme: pcca antikoerper, zgc:66359 antikoerper, C79630 antikoerper, wu:fb92g02 antikoerper, zgc:100925 antikoerper, propionyl-CoA carboxylase alpha subunit antikoerper, propionyl-COA carboxylase alpha chain, mitochondrial antikoerper, propionyl-CoA carboxylase alpha chain antikoerper, zinc finger CCCH-type containing 13 antikoerper, propionyl-Coenzyme A carboxylase, alpha polypeptide antikoerper, propionyl CoA carboxylase, alpha polypeptide antikoerper, propionyl-CoA carboxylase alpha subunit L homeolog antikoerper, PCCA antikoerper, Pcca antikoerper, BMEI0800 antikoerper, pccA antikoerper, NRI_0781 antikoerper, zc3h13 antikoerper, pcca antikoerper, pcca.L antikoerper

Hintergrund: PCCA is the alpha subunit of the heterodimeric mitochondrial enzyme Propionyl-CoA carboxylase. PCCA is the biotin-binding region of this enzyme. Mutations in either PCCA or PCCB (encoding the beta subunit) lead to an enzyme deficiency resulting in propionic acidemia.

Molekulargewicht: 75 kDa (MW of target protein)

Pathways: Monocarboxylic Acid Catabolic Process