NAD-ME Antikörper

Produktnummer ABIN631085

Produktdetails anti-NAD-ME Antikörper

Target: NAD-ME (NAD Dependent Malate Dehydrogenase (NAD-ME))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NAD-ME Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: ME2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MAFTLQERQMLGLQGLLPPKIETQDIQALRFHRNLKKMTSPLEKYIYIMG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ME2 Blocking Peptide, catalog no. 33R-5654, is also available for use as a blocking control in assays to test for specificity of this ME2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ME2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NAD-ME

Target: NAD-ME (NAD Dependent Malate Dehydrogenase (NAD-ME))

Andere Bezeichnung: ME2 (NAD-ME Produkte)

Synonyme: ODS1 antikoerper, AW120568 antikoerper, D030040L20Rik antikoerper, NAD-ME antikoerper, zgc:100941 antikoerper, malic enzyme 2 antikoerper, malic enzyme 2, NAD(+)-dependent, mitochondrial antikoerper, malic enzyme 2, NAD(+)-dependent, mitochondrial S homeolog antikoerper, ME2 antikoerper, Me2 antikoerper, me2.S antikoerper, me2 antikoerper

Hintergrund: ME2 is a mitochondrial NAD-dependent malic enzyme, a homotetrameric protein, that catalyzes the oxidative decarboxylation of malate to pyruvate. It had previously been weakly linked to a syndrome known as Friedreich ataxia that has since been shown to be the result of mutation in a completely different gene.

Molekulargewicht: 65 kDa (MW of target protein)

Pathways: Production of Molecular Mediator of Immune Response