Aminomethyltransferase Antikörper (N-Term)
-
- Target Alle Aminomethyltransferase (AMT) Antikörper anzeigen
- Aminomethyltransferase (AMT)
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Aminomethyltransferase Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- AMT antibody was raised against the N terminal of AMT
- Aufreinigung
- Affinity purified
- Immunogen
- AMT antibody was raised using the N terminal of AMT corresponding to a region with amino acids QRAVSVVARLGFRLQAFPPALCRPLSCAQEVLRRTPLYDFHLAHGGKMVA
- Top Product
- Discover our top product AMT Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
AMT Blocking Peptide, catalog no. 33R-7703, is also available for use as a blocking control in assays to test for specificity of this AMT antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AMT antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Aminomethyltransferase (AMT)
- Andere Bezeichnung
- AMT (AMT Produkte)
- Hintergrund
- The enzyme system for cleavage of glycine (glycine cleavage system, EC 2.1.2.10), which is confined to the mitochondria, is composed of 4 protein components: P protein (a pyridoxal phosphate-dependent glycine decarboxylase), H protein (a lipoic acid-containing protein), T protein (a tetrahydrofolate-requiring enzyme), and L protein (a lipoamide dehydrogenase). Glycine encephalopathy (GCE) may be due to a defect in any one of these enzymes.
- Molekulargewicht
- 44 kDa (MW of target protein)
-