WDR8 Antikörper (Middle Region)

Produktnummer ABIN631094

Produktdetails anti-WDR8 Antikörper

Target: WDR8 (WD Repeat Domain 8 (WDR8))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser WDR8 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: WDR8 antibody was raised against the middle region of WDR8

Aufreinigung: Affinity purified

Immunogen: WDR8 antibody was raised using the middle region of WDR8 corresponding to a region with amino acids GCLSFPPPRAGAGPLPSSESKYEIASVPVSLQTLKPVTDRANPKMGIGML

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

WDR8 Blocking Peptide, catalog no. 33R-3188, is also available for use as a blocking control in assays to test for specificity of this WDR8 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WDR8 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu WDR8

Target: WDR8 (WD Repeat Domain 8 (WDR8))

Andere Bezeichnung: WDR8 (WDR8 Produkte)

Synonyme: fi45a07 antikoerper, zgc:56287 antikoerper, wu:fi45a07 antikoerper, Wdr8 antikoerper, MGC75994 antikoerper, WDR8 antikoerper, MGC85022 antikoerper, 2610044M17Rik antikoerper, 5330425N03Rik antikoerper, Dd57 antikoerper, WD repeat containing, antisense to TP73 antikoerper, WD repeat containing, antisense to TP73 L homeolog antikoerper, WD repeat containing, antisense to Trp73 antikoerper, wrap73 antikoerper, Wrap73 antikoerper, WRAP73 antikoerper, wrap73.L antikoerper

Hintergrund: This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD).

Molekulargewicht: 51 kDa (MW of target protein)