CHCHD4 Antikörper (N-Term)

Produktnummer ABIN631099

Produktdetails anti-CHCHD4 Antikörper

Target: CHCHD4 (Coiled-Coil-Helix-Coiled-Coil-Helix Domain Containing 4 (CHCHD4))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CHCHD4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CHCHD4 antibody was raised against the N terminal of CHCHD4

Aufreinigung: Affinity purified

Immunogen: CHCHD4 antibody was raised using the N terminal of CHCHD4 corresponding to a region with amino acids MSYCRQEGKDRIIFVTKEDHETPSSAELVADDPNDPYEEHGLILPNGNIN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CHCHD4 Blocking Peptide, catalog no. 33R-6527, is also available for use as a blocking control in assays to test for specificity of this CHCHD4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHCHD4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CHCHD4

Target: CHCHD4 (Coiled-Coil-Helix-Coiled-Coil-Helix Domain Containing 4 (CHCHD4))

Andere Bezeichnung: CHCHD4 (CHCHD4 Produkte)

Synonyme: 2410012P20Rik antikoerper, 2810014D17Rik antikoerper, AI838740 antikoerper, MIA40 antikoerper, TIMM40 antikoerper, mia40 antikoerper, timm40 antikoerper, chchd4 antikoerper, chchd4a antikoerper, fc10g04 antikoerper, wu:fc10g04 antikoerper, zgc:100849 antikoerper, si:dkey-202e22.1 antikoerper, chchd4b antikoerper, CaO19.2977 antikoerper, coiled-coil-helix-coiled-coil-helix domain containing 4 antikoerper, coiled-coil-helix-coiled-coil-helix domain containing 4 L homeolog antikoerper, coiled-coil-helix-coiled-coil-helix domain containing 4a antikoerper, coiled-coil-helix-coiled-coil-helix domain containing 4 S homeolog antikoerper, Mia40p antikoerper, Chchd4 antikoerper, CHCHD4 antikoerper, chchd4 antikoerper, chchd4.L antikoerper, chchd4a antikoerper, chchd4.S antikoerper, LOC100361898 antikoerper, MIA40 antikoerper

Hintergrund: CHCHD4, a component of human mitochondria, belongs to a protein family whose members share 6 highly conserved cysteine residues constituting a -CXC-CX(9)C-CX(9)C- motif in the C terminus.

Molekulargewicht: 16 kDa (MW of target protein)