SPATA5 Antikörper (Middle Region)

Produktnummer ABIN631101

Produktdetails anti-SPATA5 Antikörper

Target: SPATA5 (Spermatogenesis Associated 5 (SPATA5))

Bindungsspezifität: Middle Region

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SPATA5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SPATA5 antibody was raised against the middle region of SPATA5

Aufreinigung: Affinity purified

Immunogen: SPATA5 antibody was raised using the middle region of SPATA5 corresponding to a region with amino acids ALLALEEDIQANLIMKRHFTQALSTVTPRIPESLRRFYEDYQEKSGLHTL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SPATA5 Blocking Peptide, catalog no. 33R-1347, is also available for use as a blocking control in assays to test for specificity of this SPATA5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SPATA5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SPATA5

Target: SPATA5 (Spermatogenesis Associated 5 (SPATA5))

Andere Bezeichnung: SPATA5 (SPATA5 Produkte)

Synonyme: AFG2 antikoerper, SPAF antikoerper, 2510048F20Rik antikoerper, C78064 antikoerper, Spaf antikoerper, spermatogenesis associated 5 antikoerper, SPATA5 antikoerper, Spata5 antikoerper

Hintergrund: SPATA5 may be involved in morphological and functional mitochondrial transformations during spermatogenesis.

Molekulargewicht: 98 kDa (MW of target protein)