MTCH2 Antikörper

Produktnummer ABIN631106

Produktdetails anti-MTCH2 Antikörper

Target: MTCH2 (Mitochondrial Carrier 2 (MTCH2))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MTCH2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: MTCH2 antibody was raised using a synthetic peptide corresponding to a region with amino acids ADAASQVLLGSGLTILSQPLMYVKVLIQVGYEPLPPTIGRNIFGRQVCQL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MTCH2 Blocking Peptide, catalog no. 33R-1082, is also available for use as a blocking control in assays to test for specificity of this MTCH2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MTCH2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MTCH2

Target: MTCH2 (Mitochondrial Carrier 2 (MTCH2))

Andere Bezeichnung: MTCH2 (MTCH2 Produkte)

Synonyme: MIMP antikoerper, SLC25A50 antikoerper, Hspc032 antikoerper, fi20c06 antikoerper, fj35g12 antikoerper, wu:fi20c06 antikoerper, wu:fj35g12 antikoerper, 2310034D24Rik antikoerper, 4930539J07Rik antikoerper, HSPC032 antikoerper, mitochondrial carrier 2 antikoerper, mitochondrial carrier 2 L homeolog antikoerper, mitochondrial carrier homolog 2 antikoerper, MTCH2 antikoerper, mtch2.L antikoerper, Mtch2 antikoerper, mtch2 antikoerper

Hintergrund: MTCH2 belongs to the mitochondrial carrier family. It contains 2 Solcar repeats. The substrate transported is not yet known. It induces mitochondrial depolarization.

Molekulargewicht: 33 kDa (MW of target protein)