RPS21 Antikörper (N-Term)

Produktnummer ABIN631108

Produktdetails anti-RPS21 Antikörper

Target: RPS21 (Ribosomal Protein S21 (RPS21))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RPS21 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RPS21 antibody was raised against the N terminal of RPS21

Aufreinigung: Affinity purified

Immunogen: RPS21 antibody was raised using the N terminal of RPS21 corresponding to a region with amino acids MQNDAGEFVDLYVPRKCSASNRIIGAKDHASIQMNVAEVDKVTGRFNGQF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RPS21 Blocking Peptide, catalog no. 33R-6335, is also available for use as a blocking control in assays to test for specificity of this RPS21 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPS21 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RPS21

Target: RPS21 (Ribosomal Protein S21 (RPS21))

Andere Bezeichnung: RPS21 (RPS21 Produkte)

Synonyme: CG2986 antikoerper, Dmel\\CG2986 antikoerper, M(2)23B antikoerper, l(2)03575 antikoerper, l(2)168/14 antikoerper, l(2)k16814 antikoerper, oho23 antikoerper, oho23B antikoerper, rpS21 antikoerper, RPS21 antikoerper, S21 antikoerper, 1810049N11Rik antikoerper, 2410030A14Rik antikoerper, zgc:56642 antikoerper, zgc:86816 antikoerper, Ribosomal protein S21 antikoerper, 40S ribosomal protein S21 antikoerper, ribosomal protein S21 antikoerper, ribosomal protein S21 S homeolog antikoerper, RpS21 antikoerper, rps21b antikoerper, rps-21 antikoerper, RPS21 antikoerper, Rps21 antikoerper, rps21 antikoerper, rps21.S antikoerper

Hintergrund: Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins.

Molekulargewicht: 9 kDa (MW of target protein)