RNF207 Antikörper (N-Term)

Produktnummer ABIN631110

Produktdetails anti-RNF207 Antikörper

Target: RNF207 (RING Finger Protein 207 (RNF207))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RNF207 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RNF207 antibody was raised against the N terminal of RNF207

Aufreinigung: Affinity purified

Immunogen: RNF207 antibody was raised using the N terminal of RNF207 corresponding to a region with amino acids CLLDCFHDFCAGCLRGRATDGRLTCPLCQHQTVLKGPSGLPPVDRLLQFL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RNF207 Blocking Peptide, catalog no. 33R-1739, is also available for use as a blocking control in assays to test for specificity of this RNF207 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNF207 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RNF207

Target: RNF207 (RING Finger Protein 207 (RNF207))

Andere Bezeichnung: RNF207 (RNF207 Produkte)

Synonyme: C1orf188 antikoerper, D330010C22Rik antikoerper, Gm143 antikoerper, ring finger protein 207 antikoerper, RNF207 antikoerper, Rnf207 antikoerper

Hintergrund: RNF207 contains 1 B box-type zinc finger and 1 RING-type zinc finger. The function of the RNF207 protein remains unknown.

Molekulargewicht: 71 kDa (MW of target protein)