PIWIL1 Antikörper
-
- Target Alle PIWIL1 Antikörper anzeigen
- PIWIL1 (Piwi-Like 1 (PIWIL1))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PIWIL1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- PIWIL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LTYKLCHIYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREPNLSLSNRLYY
- Top Product
- Discover our top product PIWIL1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PIWIL1 Blocking Peptide, catalog no. 33R-5494, is also available for use as a blocking control in assays to test for specificity of this PIWIL1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PIWIL1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PIWIL1 (Piwi-Like 1 (PIWIL1))
- Andere Bezeichnung
- PIWIL1 (PIWIL1 Produkte)
- Synonyme
- ziwi antikoerper, PIWI antikoerper, HIWI antikoerper, MIWI antikoerper, piwi like RNA-mediated gene silencing 1 antikoerper, PIWI-like protein 1 antikoerper, putative PIWI-like protein 1 antikoerper, putative argonaut-like protein antikoerper, piwi-like RNA-mediated gene silencing 1 antikoerper, PIWIL1 antikoerper, Tb10.70.5520 antikoerper, LINJ_21_0470 antikoerper, LBRM_21_0470 antikoerper, piwil1 antikoerper, Piwil1 antikoerper
- Hintergrund
- PIWIL1 is a member of the PIWI subfamily of Argonaute proteins, evolutionarily conserved proteins containing both PAZ and Piwi motifs that play important roles in stem cell self-renewal, RNA silencing, and translational regulation in diverse organisms. PIWIL1 may play a role as an intrinsic regulator of the self-renewal capacity of germline and hematopoietic stem cells.
- Molekulargewicht
- 98 kDa (MW of target protein)
-