EIF2C3 Antikörper (N-Term)
-
- Target Alle EIF2C3 Antikörper anzeigen
- EIF2C3 (Eukaryotic Translation Initiation Factor 2C3 (EIF2C3))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser EIF2C3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- EIF2 C3 antibody was raised against the N terminal of EIF2 3
- Aufreinigung
- Affinity purified
- Immunogen
- EIF2 C3 antibody was raised using the N terminal of EIF2 3 corresponding to a region with amino acids MCEVLDIHNIDEQPRPLTDSHRVKFTKEIKGLKVEVTHCGTMRRKYRVCN
- Top Product
- Discover our top product EIF2C3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
EIF2C3 Blocking Peptide, catalog no. 33R-5810, is also available for use as a blocking control in assays to test for specificity of this EIF2C3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF0 3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- EIF2C3 (Eukaryotic Translation Initiation Factor 2C3 (EIF2C3))
- Andere Bezeichnung
- EIF2C3 (EIF2C3 Produkte)
- Hintergrund
- EIF2C3 is a member of the Argonaute family of proteins which play a role in RNA interference. The encoded protein is highly basic, contains a PAZ domain and a PIWI domain, and may play a role in short-interfering-RNA-mediated gene silencing.
- Molekulargewicht
- 69 kDa (MW of target protein)
- Pathways
- Fc-epsilon Rezeptor Signalübertragung, Regulatorische RNA Pathways, EGFR Signaling Pathway, Neurotrophin Signalübertragung
-