EIF2C3 Antikörper (N-Term)

Produktnummer ABIN631112

Produktdetails anti-EIF2C3 Antikörper

Target: EIF2C3 (Eukaryotic Translation Initiation Factor 2C3 (EIF2C3))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser EIF2C3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: EIF2 C3 antibody was raised against the N terminal of EIF2 3

Aufreinigung: Affinity purified

Immunogen: EIF2 C3 antibody was raised using the N terminal of EIF2 3 corresponding to a region with amino acids MCEVLDIHNIDEQPRPLTDSHRVKFTKEIKGLKVEVTHCGTMRRKYRVCN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

EIF2C3 Blocking Peptide, catalog no. 33R-5810, is also available for use as a blocking control in assays to test for specificity of this EIF2C3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF0 3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu EIF2C3

Target: EIF2C3 (Eukaryotic Translation Initiation Factor 2C3 (EIF2C3))

Andere Bezeichnung: EIF2C3 (EIF2C3 Produkte)

Synonyme: EIF2C3 antikoerper, Eif2c3 antikoerper, Argonaute3 antikoerper, ago3 antikoerper, eif2c3 antikoerper, eif2c3b antikoerper, si:dkey-3n22.3 antikoerper, AW048688 antikoerper, C130014L07Rik antikoerper, ARGONAUTE 3 antikoerper, T19E23.8 antikoerper, T19E23_8 antikoerper, argonaute 3, RISC catalytic component antikoerper, argonaute RISC catalytic component 3b antikoerper, argonaute RISC catalytic subunit 3 antikoerper, argonaute RISC catalytic component 3 antikoerper, ARGONAUTE 3 antikoerper, AGO3 antikoerper, Ago3 antikoerper, ago3b antikoerper

Hintergrund: EIF2C3 is a member of the Argonaute family of proteins which play a role in RNA interference. The encoded protein is highly basic, contains a PAZ domain and a PIWI domain, and may play a role in short-interfering-RNA-mediated gene silencing.

Molekulargewicht: 69 kDa (MW of target protein)

Pathways: Fc-epsilon Rezeptor Signalübertragung, Regulatorische RNA Pathways, EGFR Signaling Pathway, Neurotrophin Signalübertragung