Lactate Dehydrogenase C Antikörper (Middle Region)
-
- Target Alle Lactate Dehydrogenase C (LDHC) Antikörper anzeigen
- Lactate Dehydrogenase C (LDHC)
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Lactate Dehydrogenase C Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- LDHC antibody was raised against the middle region of LDHC
- Aufreinigung
- Affinity purified
- Immunogen
- LDHC antibody was raised using the middle region of LDHC corresponding to a region with amino acids IVIVTAGARQQEGETRLALVQRNVAIMKSIIPAIVHYSPDCKILVVSNPV
- Top Product
- Discover our top product LDHC Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
LDHC Blocking Peptide, catalog no. 33R-4202, is also available for use as a blocking control in assays to test for specificity of this LDHC antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LDHC antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Lactate Dehydrogenase C (LDHC)
- Andere Bezeichnung
- LDHC (LDHC Produkte)
- Synonyme
- CT32 antikoerper, LDH3 antikoerper, LDHX antikoerper, LDH-C4 antikoerper, Ldh-3 antikoerper, Ldh-x antikoerper, Ldh3 antikoerper, Ldhc4 antikoerper, LDH-C antikoerper, LDH-X antikoerper, lactate dehydrogenase C antikoerper, L-lactate dehydrogenase C chain antikoerper, LDHC antikoerper, Ldhc antikoerper, ldhc antikoerper, LOC100713414 antikoerper, LOC100343171 antikoerper
- Hintergrund
- Lactate dehydrogenase C catalyzes the conversion of L-lactate and NAD to pyruvate and NADH in the final step of anaerobic glycolysis. LDHC is testis-specific and belongs to the lactate dehydrogenase family.
- Molekulargewicht
- 36 kDa (MW of target protein)
- Pathways
- Ribonucleoside Biosynthetic Process, Warburg Effekt
-