TUFM Antikörper (Middle Region)
-
- Target Alle TUFM (Tufm) Antikörper anzeigen
- TUFM (Tufm) (Tu Translation Elongation Factor, Mitochondrial (Tufm))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TUFM Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- TUFM antibody was raised against the middle region of TUFM
- Aufreinigung
- Affinity purified
- Immunogen
- TUFM antibody was raised using the middle region of TUFM corresponding to a region with amino acids PEKELAMPGEDLKFNLILRQPMILEKGQRFTLRDGNRTIGTGLVTNTLAM
- Top Product
- Discover our top product Tufm Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
TUFM Blocking Peptide, catalog no. 33R-7046, is also available for use as a blocking control in assays to test for specificity of this TUFM antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TUFM antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TUFM (Tufm) (Tu Translation Elongation Factor, Mitochondrial (Tufm))
- Andere Bezeichnung
- TUFM (Tufm Produkte)
- Synonyme
- TUFM antikoerper, D250 antikoerper, fi06f04 antikoerper, wu:fi06f04 antikoerper, zgc:110766 antikoerper, COXPD4 antikoerper, EF-TuMT antikoerper, EFTU antikoerper, P43 antikoerper, 2300002G02Rik antikoerper, C76308 antikoerper, C76389 antikoerper, Tu translation elongation factor, mitochondrial antikoerper, TUFM antikoerper, tufm antikoerper, Tufm antikoerper
- Hintergrund
- TUFM is a protein which participates in protein translation in mitochondria. Mutations in this gene have been associated with combined oxidative phosphorylation deficiency resulting in lactic acidosis and fatal encephalopathy.
- Molekulargewicht
- 50 kDa (MW of target protein)
-