BRWD1 Antikörper (N-Term)

Produktnummer ABIN631121

Produktdetails anti-BRWD1 Antikörper

Target: BRWD1 (Bromodomain and WD Repeat Domain Containing 1 (BRWD1))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser BRWD1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: BRWD1 antibody was raised against the N terminal of BRWD1

Aufreinigung: Affinity purified

Immunogen: BRWD1 antibody was raised using the N terminal of BRWD1 corresponding to a region with amino acids MAEPSSARRPVPLIESELYFLIARYLSAGPCRRAAQVLVQELEQYQLLPK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

BRWD1 Blocking Peptide, catalog no. 33R-5643, is also available for use as a blocking control in assays to test for specificity of this BRWD1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BRWD1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu BRWD1

Target: BRWD1 (Bromodomain and WD Repeat Domain Containing 1 (BRWD1))

Andere Bezeichnung: BRWD1 (BRWD1 Produkte)

Synonyme: WDR9 antikoerper, BRWD1 antikoerper, C21orf107 antikoerper, N143 antikoerper, 5330419I02Rik antikoerper, D530019K20Rik antikoerper, G1-403-16 antikoerper, Wdr9 antikoerper, repro5 antikoerper, bromodomain and WD repeat domain containing 1 antikoerper, bromodomain and WD repeat-containing protein 1 antikoerper, BRWD1 antikoerper, LOC100226455 antikoerper, brwd1 antikoerper, Brwd1 antikoerper

Hintergrund: This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein com

Molekulargewicht: 13 kDa (MW of target protein)