PACRG Antikörper (Middle Region)
-
- Target Alle PACRG Antikörper anzeigen
- PACRG (PARK2 Co-Regulated (PACRG))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PACRG Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PACRG antibody was raised against the middle region of PACRG
- Aufreinigung
- Affinity purified
- Immunogen
- PACRG antibody was raised using the middle region of PACRG corresponding to a region with amino acids GAIMARCNLDHLGSSDPPTSASQVAEIIVNSGDGIDYSQQKRENIGDLIQ
- Top Product
- Discover our top product PACRG Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PACRG Blocking Peptide, catalog no. 33R-3157, is also available for use as a blocking control in assays to test for specificity of this PACRG antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PACRG antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PACRG (PARK2 Co-Regulated (PACRG))
- Andere Bezeichnung
- PACRG (PACRG Produkte)
- Synonyme
- PACRG antikoerper, GLUP antikoerper, HAK005771 antikoerper, PARK2CRG antikoerper, RP3-495O10.2 antikoerper, zgc:101786 antikoerper, RGD1561027 antikoerper, 1700008H23Rik antikoerper, parkin coregulated antikoerper, PARK2 co-regulated antikoerper, PARK2 coregulated antikoerper, PACRG antikoerper, pacrg antikoerper, Pacrg antikoerper
- Hintergrund
- PACRG is a protein that is conserved across metazoans. In vertebrates, this gene is linked in a head-to-head arrangement with the adjacent parkin gene, which is associated with autosomal recessive juvenile Parkinson's disease. These genes are co-regulated in various tissues and they share a bi-directional promoter. Both genes are associated with susceptibility to leprosy.
- Molekulargewicht
- 33 kDa (MW of target protein)
-