TXNDC5 Antikörper (N-Term)

Produktnummer ABIN631124

Produktdetails anti-TXNDC5 Antikörper

Target: TXNDC5 (Thioredoxin Domain Containing 5 (Endoplasmic Reticulum) (TXNDC5))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TXNDC5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TXNDC5 antibody was raised against the N terminal of TXNDC5

Aufreinigung: Affinity purified

Immunogen: TXNDC5 antibody was raised using the N terminal of TXNDC5 corresponding to a region with amino acids ARAQEAAAAAADGPPAADGEDGQDPHSKHLYTADMFTHGIQSAAHFVMFF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TXNDC5 Blocking Peptide, catalog no. 33R-1460, is also available for use as a blocking control in assays to test for specificity of this TXNDC5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TXNDC5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TXNDC5

Target: TXNDC5 (Thioredoxin Domain Containing 5 (Endoplasmic Reticulum) (TXNDC5))

Andere Bezeichnung: TXNDC5 (TXNDC5 Produkte)

Synonyme: ENDOPDI antikoerper, ERP46 antikoerper, HCC-2 antikoerper, PDIA15 antikoerper, STRF8 antikoerper, UNQ364 antikoerper, wu:fb20a07 antikoerper, wu:fb55b10 antikoerper, zgc:66265 antikoerper, AL022641 antikoerper, ERp46 antikoerper, PC-TRP antikoerper, PDIL5-1 antikoerper, Txndc5 antikoerper, erp46 antikoerper, TXNDC5 antikoerper, MUTED antikoerper, endopdi antikoerper, unq364 antikoerper, thioredoxin domain containing 5 antikoerper, protein disulfide isomerase antikoerper, thioredoxin domain containing 5 L homeolog antikoerper, biogenesis of lysosomal organelles complex 1 subunit 5 antikoerper, TXNDC5 antikoerper, txndc5 antikoerper, Txndc5 antikoerper, PDIL5-1 antikoerper, txndc5.L antikoerper, BLOC1S5 antikoerper, CC1G_08236 antikoerper

Hintergrund: TXNDC5 is a protein-disulfide isomerase. Its expression is induced by hypoxia and its role may be to protect hypoxic cells from apoptosis.

Molekulargewicht: 48 kDa (MW of target protein)

Pathways: Cell RedoxHomeostasis