PYGB Antikörper (N-Term)

Produktnummer ABIN631127

Produktdetails anti-PYGB Antikörper

Target: PYGB (GPBB) (phosphorylase, Glycogen, Brain (GPBB))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PYGB Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PYGB antibody was raised against the N terminal of PYGB

Aufreinigung: Affinity purified

Immunogen: PYGB antibody was raised using the N terminal of PYGB corresponding to a region with amino acids QQHYYERDPKRIYYLSLEFYMGRTLQNTMVNLGLQNACDEAIYQLGLDLE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PYGB Blocking Peptide, catalog no. 33R-7693, is also available for use as a blocking control in assays to test for specificity of this PYGB antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PYGB antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PYGB

Target: PYGB (GPBB) (phosphorylase, Glycogen, Brain (GPBB))

Andere Bezeichnung: PYGB (GPBB Produkte)

Synonyme: GPBB antikoerper, GLYPHOA antikoerper, glycogen phosphorylase B antikoerper, phosphorylase, glycogen; brain antikoerper, brain glycogen phosphorylase antikoerper, phosphorylase, glycogen; brain S homeolog antikoerper, PYGB antikoerper, pygb antikoerper, Pygb antikoerper, pygb.S antikoerper

Hintergrund: PYGB is a glycogen phosphorylase found predominantly in the brain. It forms homodimers which can associate into homotetramers, the enzymatically active form of glycogen phosphorylase. The activity of this enzyme is positively regulated by AMP and negatively regulated by ATP, ADP, and glucose-6-phosphate. This enzyme catalyzes the rate-determining step in glycogen degradation.

Molekulargewicht: 97 kDa (MW of target protein)

Pathways: Cellular Glucan Metabolic Process