SELENBP1 Antikörper (N-Term)

Produktnummer ABIN631129

Produktdetails anti-SELENBP1 Antikörper

Target: SELENBP1 (Selenium Binding Protein 1 (SELENBP1))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SELENBP1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SELENBP1 antibody was raised against the N terminal of SELENBP1

Aufreinigung: Affinity purified

Immunogen: SELENBP1 antibody was raised using the N terminal of SELENBP1 corresponding to a region with amino acids MATKCGNCGPGYSTPLEAMKGPREEIVYLPCIYRNTGTEAPDYLATVDVD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SELENBP1 Blocking Peptide, catalog no. 33R-5778, is also available for use as a blocking control in assays to test for specificity of this SELENBP1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SELENBP1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SELENBP1

Target: SELENBP1 (Selenium Binding Protein 1 (SELENBP1))

Andere Bezeichnung: SELENBP1 (SELENBP1 Produkte)

Synonyme: zgc:65844 antikoerper, hsbp antikoerper, lpsb antikoerper, sp56 antikoerper, sbp56 antikoerper, MGC82850 antikoerper, SELENBP1 antikoerper, LPSB antikoerper, SBP56 antikoerper, SP56 antikoerper, hSBP antikoerper, Lp56 antikoerper, Lpsb antikoerper, Selenbp2 antikoerper, selenbp1 antikoerper, SBP antikoerper, DL3055C antikoerper, FCAALL.79 antikoerper, selenium-binding protein 1 antikoerper, selenium binding protein 1 antikoerper, selenium binding protein 1 S homeolog antikoerper, selenium binding protein 1 L homeolog antikoerper, selenium-binding protein 1 antikoerper, selenbp1 antikoerper, SELENBP1 antikoerper, selenbp1.S antikoerper, Selenbp1 antikoerper, selenbp1.L antikoerper, SBP1 antikoerper

Hintergrund: SELENBP1 belongs to the selenium-binding protein family. Selenium is an essential nutrient that exhibits potent anticarcinogenic properties, and deficiency of selenium may cause certain neurologic diseases. It has been proposed that the effects of selenium in preventing cancer and neurologic diseases may be mediated by selenium-binding proteins.

Molekulargewicht: 52 kDa (MW of target protein)

Pathways: Brown Fat Cell Differentiation