AKAP5 Antikörper

Produktnummer ABIN631131

Produktdetails anti-AKAP5 Antikörper

Target: AKAP5 (A Kinase (PRKA) Anchor Protein 5 (AKAP5))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser AKAP5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: AKAP5 antibody was raised using a synthetic peptide corresponding to a region with amino acids KQFLISAENEQVGVFANDNGFEDRTSEQYETLLIETASSLVKNAIQLSIE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

AKAP5 Blocking Peptide, catalog no. 33R-4603, is also available for use as a blocking control in assays to test for specificity of this AKAP5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AKAP5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu AKAP5

Target: AKAP5 (A Kinase (PRKA) Anchor Protein 5 (AKAP5))

Andere Bezeichnung: AKAP5 (AKAP5 Produkte)

Synonyme: AKAP5 antikoerper, AKAP75 antikoerper, AKAP79 antikoerper, H21 antikoerper, AKAP antikoerper, P75 antikoerper, 3526401B18Rik antikoerper, AKAP 150 antikoerper, AKAP-5 antikoerper, AKAP150 antikoerper, BB098886 antikoerper, Gm258 antikoerper, P150 antikoerper, Akap79 antikoerper, A kinase (PRKA) anchor protein 5 antikoerper, A-kinase anchoring protein 5 antikoerper, AKAP5 antikoerper, Akap5 antikoerper

Substanzklasse: Viral Protein

Hintergrund: The A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins, which have the common function of binding to the regulatory subunit of protein kinase A (PKA) and confining the holoenzyme to discrete locations within the cell. AKAP5 is a member of the AKAP family. It binds to the RII-beta regulatory subunit of PKA, and also to protein kinase C and the phosphatase calcineurin. It is predominantly expressed in cerebral cortex and may anchor the PKA protein at postsynaptic densities (PSD) and be involved in the regulation of postsynaptic events. It is also expressed in T lymphocytes and may function to inhibit interleukin-2 transcription by disrupting calcineurin-dependent dephosphorylation of NFAT.

Molekulargewicht: 47 kDa (MW of target protein)

Pathways: cAMP Metabolic Process