ZCCHC12 Antikörper (N-Term)

Produktnummer ABIN631133

Produktdetails anti-ZCCHC12 Antikörper

Target: ZCCHC12 (Zinc Finger, CCHC Domain Containing 12 (ZCCHC12))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ZCCHC12 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ZCCHC12 antibody was raised against the N terminal of ZCCHC12

Aufreinigung: Affinity purified

Immunogen: ZCCHC12 antibody was raised using the N terminal of ZCCHC12 corresponding to a region with amino acids AREVMRVLQATNPNLSVADFLRAMKLVFGESESSVTAHGKFFNTLQAQGE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ZCCHC12 Blocking Peptide, catalog no. 33R-1469, is also available for use as a blocking control in assays to test for specificity of this ZCCHC12 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZCCHC12 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ZCCHC12

Target: ZCCHC12 (Zinc Finger, CCHC Domain Containing 12 (ZCCHC12))

Andere Bezeichnung: ZCCHC12 (ZCCHC12 Produkte)

Synonyme: PNMA7A antikoerper, SIZN antikoerper, SIZN1 antikoerper, 2810028A01Rik antikoerper, AV136720 antikoerper, Sizn1 antikoerper, zinc finger CCHC-type containing 12 antikoerper, sterile alpha motif domain containing 12 antikoerper, zinc finger, CCHC domain containing 12 antikoerper, ZCCHC12 antikoerper, samd12 antikoerper, Zcchc12 antikoerper

Hintergrund: ZCCHC12 contains 1 CCHC-type zinc finger. ZCCHC12 is the transcriptional coactivator in the bone morphogenetic protein (BMP)-signaling pathway. It positively modulates BMP signaling by interacting with SMAD1 and associating with CBP in the transcription complex. It contributes to the BMP-induced enhancement of cholinergic-neuron-specific gene expression.

Molekulargewicht: 45 kDa (MW of target protein)