IER5 Antikörper (N-Term)
-
- Target Alle IER5 Antikörper anzeigen
- IER5 (Immediate Early Response 5 (IER5))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser IER5 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- IER5 antibody was raised against the N terminal of IER5
- Aufreinigung
- Affinity purified
- Immunogen
- IER5 antibody was raised using the N terminal of IER5 corresponding to a region with amino acids MEFKLEAHRIVSISLGKIYNSRVQRGGIKLHKNLLVSLVLRSARQVYLSD
- Top Product
- Discover our top product IER5 Primärantikörper
-
anti-Immediate Early Response 5 (IER5) (AA 1-327) antibody
IER5 Reaktivität: Human WB Wirt: Maus Polyclonal unconjugated
anti-Immediate Early Response 5 (IER5) (AA 122-149) antibodyIER5 Reaktivität: Human WB Wirt: Kaninchen Polyclonal RB37262 unconjugated
anti-Immediate Early Response 5 (IER5) (AA 1-56) antibodyIER5 Reaktivität: Human WB, ELISA Wirt: Maus Polyclonal unconjugated
anti-Immediate Early Response 5 (IER5) (N-Term) antibodyIER5 Reaktivität: Human, Maus, Ratte, Rind (Kuh), Meerschweinchen, Zebrafisch (Danio rerio), Fledermaus, Affe WB Wirt: Kaninchen Polyclonal unconjugated
anti-Immediate Early Response 5 (IER5) (N-Term) antibodyIER5 Reaktivität: Human, Maus, Ratte, Rind (Kuh), Meerschweinchen, Zebrafisch (Danio rerio), Hund WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
IER5 Blocking Peptide, catalog no. 33R-5913, is also available for use as a blocking control in assays to test for specificity of this IER5 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IER5 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- IER5 (Immediate Early Response 5 (IER5))
- Andere Bezeichnung
- IER5 (IER5 Produkte)
- Synonyme
- si:dz129i22.1 antikoerper, wu:fa99a02 antikoerper, wu:fb04b03 antikoerper, wu:fb11f08 antikoerper, zgc:136422 antikoerper, sbbi48 antikoerper, MGC83180 antikoerper, IER5 antikoerper, SBBI48 antikoerper, immediate early response 5 antikoerper, immediate early response 5 L homeolog antikoerper, ier5 antikoerper, ier5.L antikoerper, IER5 antikoerper, Ier5 antikoerper
- Hintergrund
- This gene encodes a protein that is similar to other immediate early response proteins. In the mouse, a similar gene may play an important role in mediating the cellular response to mitogenic signals.
- Molekulargewicht
- 34 kDa (MW of target protein)
-
