TGS1 Antikörper
-
- Target Alle TGS1 Antikörper anzeigen
- TGS1 (Trimethylguanosine Synthase 1 (TGS1))
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TGS1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- TGS1 antibody was raised using a synthetic peptide corresponding to a region with amino acids IDENPASDFDDSGSLLGFKYGSGQKYGGIPNFSHRQVRYLEKNVKLKSKY
- Top Product
- Discover our top product TGS1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
TGS1 Blocking Peptide, catalog no. 33R-3910, is also available for use as a blocking control in assays to test for specificity of this TGS1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TGS1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TGS1 (Trimethylguanosine Synthase 1 (TGS1))
- Andere Bezeichnung
- TGS1 (TGS1 Produkte)
- Synonyme
- NCOA6IP antikoerper, PIMT antikoerper, PIPMT antikoerper, D4Ertd800e antikoerper, Ncoa6ip antikoerper, Pimt antikoerper, trimethylguanosine synthase 1 antikoerper, trimethylguanosine synthase 1 L homeolog antikoerper, TGS1 antikoerper, Tgs1 antikoerper, tgs1.L antikoerper
- Hintergrund
- TGS1 catalyzes the methylation step(s) for the conversion of the 7-monomethylguanosine (m7G) caps of snRNAs and snoRNAs to a 2,2,7-trimethylguanosine (m(2,2,7)G) cap structure. TGS1 plays a role in transcriptional regulation.
- Molekulargewicht
- 96 kDa (MW of target protein)
- Pathways
- Mitotic G1-G1/S Phases, Regulation of Lipid Metabolism by PPARalpha, Ribonucleoprotein Complex Subunit Organization
-