EGLN3 Antikörper

Produktnummer ABIN631137

Produktdetails anti-EGLN3 Antikörper

Target: EGLN3 (Egl-9 Family Hypoxia Inducible Factor 3 (EGLN3))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser EGLN3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: EGLN3 antibody was raised using a synthetic peptide corresponding to a region with amino acids FWSDRRNPHEVQPSYATRYAMTVWYFDAEERAEAKKKFRNLTRKTESALT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

EGLN3 Blocking Peptide, catalog no. 33R-3129, is also available for use as a blocking control in assays to test for specificity of this EGLN3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EGLN3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu EGLN3

Target: EGLN3 (Egl-9 Family Hypoxia Inducible Factor 3 (EGLN3))

Andere Bezeichnung: EGLN3 (EGLN3 Produkte)

Synonyme: zgc:77019 antikoerper, wu:fj78a08 antikoerper, EGLN3 antikoerper, phd3 antikoerper, PHD-3 antikoerper, PHD3 antikoerper, SM-20 antikoerper, 2610021G09Rik antikoerper, AI505553 antikoerper, AI648162 antikoerper, Hif-p4h-3 antikoerper, Phd3 antikoerper, HIFP4H3 antikoerper, HIFPH3 antikoerper, egl-9 family hypoxia-inducible factor 3 antikoerper, egl-9 family hypoxia inducible factor 3 antikoerper, egl-9 family hypoxia-inducible factor 3 L homeolog antikoerper, egln3 antikoerper, EGLN3 antikoerper, egln3.L antikoerper, Egln3 antikoerper

Hintergrund: EGLN3 catalyzes the post-translational formation of 4-hydroxyproline in hypoxia-inducible factor (HIF) alpha proteins. It hydroxylates HIF-1 alpha at 'Pro-564', and HIF-2 alpha. EGLN3 functions as a cellular oxygen sensor and, under normoxic conditions, targets HIF through the hydroxylation for proteasomal degradation via the von Hippel-Lindau ubiquitination complex. It may play a role in cell growth regulation in muscle cells and in apoptosis in neuronal tissue. EGLN3 promotes cell death through a caspase-dependent mechanism.

Molekulargewicht: 27 kDa (MW of target protein)

Pathways: Positive Regulation of Endopeptidase Activity