A2BP1 Antikörper (N-Term)
-
- Target Alle A2BP1 Antikörper anzeigen
- A2BP1 (Ataxin 2-Binding Protein 1 (A2BP1))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser A2BP1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- A2 BP1 antibody was raised against the N terminal of A2 P1
- Aufreinigung
- Affinity purified
- Immunogen
- A2 BP1 antibody was raised using the N terminal of A2 P1 corresponding to a region with amino acids NCEREQLRGNQEAAAAPDTMAQPYASAQFAPPQNGIPAEYTAPHPHPAPE
- Top Product
- Discover our top product A2BP1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
A2BP1 Blocking Peptide, catalog no. 33R-6652, is also available for use as a blocking control in assays to test for specificity of this A2BP1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of A0 P1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- A2BP1 (Ataxin 2-Binding Protein 1 (A2BP1))
- Andere Bezeichnung
- A2BP1 (A2BP1 Produkte)
- Hintergrund
- Ataxin-2 binding protein 1(A2BP1) has an RNP motif that is highly conserved among RNA-binding proteins. This protein binds to the C-terminus of ataxin-2 and may contribute to the restricted pathology of spinocerebellar ataxia type 2 (SCA2). Ataxin-2 is the gene product of the SCA2 gene which causes familial neurodegenerative diseases. Ataxin-2 binding protein 1 and ataxin-2 are both localized in the trans-Golgi network. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene. Additional transcript variants have been found but their full length nature has not been determined.
- Molekulargewicht
- 40 kDa (MW of target protein)
-