A2BP1 Antikörper (N-Term)

Produktnummer ABIN631141

Produktdetails anti-A2BP1 Antikörper

Target: A2BP1 (Ataxin 2-Binding Protein 1 (A2BP1))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser A2BP1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: A2 BP1 antibody was raised against the N terminal of A2 P1

Aufreinigung: Affinity purified

Immunogen: A2 BP1 antibody was raised using the N terminal of A2 P1 corresponding to a region with amino acids NCEREQLRGNQEAAAAPDTMAQPYASAQFAPPQNGIPAEYTAPHPHPAPE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

A2BP1 Blocking Peptide, catalog no. 33R-6652, is also available for use as a blocking control in assays to test for specificity of this A2BP1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of A0 P1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu A2BP1

Target: A2BP1 (Ataxin 2-Binding Protein 1 (A2BP1))

Andere Bezeichnung: A2BP1 (A2BP1 Produkte)

Synonyme: A2BP1 antikoerper, fox1 antikoerper, a2bp1 antikoerper, zgc:103635 antikoerper, 2BP1 antikoerper, FOX-1 antikoerper, FOX1 antikoerper, HRNBP1 antikoerper, A2bp antikoerper, A2bp1 antikoerper, Hrnbp1 antikoerper, fox-1 antikoerper, RNA binding protein, fox-1 homolog 1 antikoerper, RNA binding fox-1 homolog 1 antikoerper, multicopper ferroxidase antikoerper, RNA binding protein, fox-1 homolog (C. elegans) 1 antikoerper, RBFOX1 antikoerper, rbfox1 antikoerper, FOX1 antikoerper, Rbfox1 antikoerper

Hintergrund: Ataxin-2 binding protein 1(A2BP1) has an RNP motif that is highly conserved among RNA-binding proteins. This protein binds to the C-terminus of ataxin-2 and may contribute to the restricted pathology of spinocerebellar ataxia type 2 (SCA2). Ataxin-2 is the gene product of the SCA2 gene which causes familial neurodegenerative diseases. Ataxin-2 binding protein 1 and ataxin-2 are both localized in the trans-Golgi network. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene. Additional transcript variants have been found but their full length nature has not been determined.

Molekulargewicht: 40 kDa (MW of target protein)