OGFOD1 Antikörper (Middle Region)

Produktnummer ABIN631145

Produktdetails anti-OGFOD1 Antikörper

Target: OGFOD1 (2-Oxoglutarate and Iron-Dependent Oxygenase Domain Containing 1 (OGFOD1))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser OGFOD1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: OGFOD1 antibody was raised against the middle region of OGFOD1

Aufreinigung: Affinity purified

Immunogen: OGFOD1 antibody was raised using the middle region of OGFOD1 corresponding to a region with amino acids GCEGWEPEYGGFTSYIAKGEDEELLTVNPESNSLALVYRDRETLKFVKHI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

OGFOD1 Blocking Peptide, catalog no. 33R-3184, is also available for use as a blocking control in assays to test for specificity of this OGFOD1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OGFOD1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu OGFOD1

Target: OGFOD1 (2-Oxoglutarate and Iron-Dependent Oxygenase Domain Containing 1 (OGFOD1))

Andere Bezeichnung: OGFOD1 (OGFOD1 Produkte)

Synonyme: tpa1 antikoerper, MGC145343 antikoerper, D63 antikoerper, wu:fc33b08 antikoerper, zgc:66379 antikoerper, TPA1 antikoerper, 4930415J21Rik antikoerper, AA387199 antikoerper, AA939912 antikoerper, AW061076 antikoerper, mKIAA1612 antikoerper, RGD1308848 antikoerper, 2-oxoglutarate and iron dependent oxygenase domain containing 1 antikoerper, 2-oxoglutarate and iron-dependent oxygenase domain containing 1 antikoerper, 2-oxoglutarate and iron dependent oxygenase domain containing 1 L homeolog antikoerper, OGFOD1 antikoerper, ogfod1 antikoerper, ogfod1.L antikoerper, Ogfod1 antikoerper

Hintergrund: The function of OGFOD1 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 63 kDa (MW of target protein)