GSTA4 Antikörper (C-Term)

Produktnummer ABIN631150

Produktdetails anti-GSTA4 Antikörper

Target: GSTA4 (Glutathione S-Transferase alpha 4 (GSTA4))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GSTA4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: GSTA4 antibody was raised against the C terminal of GSTA4

Aufreinigung: Affinity purified

Immunogen: GSTA4 antibody was raised using the C terminal of GSTA4 corresponding to a region with amino acids LSAFPFLQEYTVKLSNIPTIKRFLEPGSKKKPPPDEIYVRTVYNIFRP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GSTA4 Blocking Peptide, catalog no. 33R-5405, is also available for use as a blocking control in assays to test for specificity of this GSTA4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GSTA4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GSTA4

Target: GSTA4 (Glutathione S-Transferase alpha 4 (GSTA4))

Andere Bezeichnung: GSTA4 (GSTA4 Produkte)

Synonyme: GSTA4-4 antikoerper, GTA4 antikoerper, gsta4-4 antikoerper, gta4 antikoerper, tGSTA4 antikoerper, GST5.7 antikoerper, mGsta4 antikoerper, glutathione S-transferase alpha 4 antikoerper, glutathione S-transferase alpha 4-like antikoerper, glutathione S-transferase alpha 4 S homeolog antikoerper, glutathione S-transferase 3 antikoerper, glutathione S-transferase, alpha 4 antikoerper, glutathione S-transferase A4 antikoerper, GSTA4 antikoerper, Gsta4 antikoerper, GSTA4L antikoerper, gsta4 antikoerper, gsta4.S antikoerper, LOC100341622 antikoerper

Hintergrund: GSTA4 is a glutathione S-tranferase belonging to the alpha class. The alpha class genes, which are located in a cluster on chromosome 6, are highly related and encode enzymes with glutathione peroxidase activity that function in the detoxification of lipid peroxidation products. Reactive electrophiles produced by oxidative metabolism have been linked to a number of degenerative diseases including Parkinson's disease, Alzheimer's disease, cataract formation, and atherosclerosis.

Molekulargewicht: 26 kDa (MW of target protein)