GAMT Antikörper (N-Term)
-
- Target Alle GAMT Antikörper anzeigen
- GAMT (Guanidinoacetate N-Methyltransferase (GAMT))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser GAMT Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- GAMT antibody was raised against the N terminal of GAMT
- Aufreinigung
- Affinity purified
- Immunogen
- GAMT antibody was raised using the N terminal of GAMT corresponding to a region with amino acids MSAPSATPIFAPGENCSPAWGAAPAAYDAADTHLRILGKPVMERWETPYM
- Top Product
- Discover our top product GAMT Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
GAMT Blocking Peptide, catalog no. 33R-6399, is also available for use as a blocking control in assays to test for specificity of this GAMT antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GAMT antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GAMT (Guanidinoacetate N-Methyltransferase (GAMT))
- Andere Bezeichnung
- GAMT (GAMT Produkte)
- Hintergrund
- GAMT is a methyltransferase that converts guanidoacetate to creatine, using S-adenosylmethionine as the methyl donor. Defects in its gene have been implicated in neurologic syndromes and muscular hypotonia, probably due to creatine deficiency and accumulation of guanidinoacetate in the brain of affected individuals.
- Molekulargewicht
- 26 kDa (MW of target protein)
-