TUSC1 Antikörper (Middle Region)
-
- Target Alle TUSC1 Antikörper anzeigen
- TUSC1 (Tumor Suppressor Candidate 1 (TUSC1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TUSC1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- TUSC1 antibody was raised against the middle region of TUSC1
- Aufreinigung
- Affinity purified
- Immunogen
- TUSC1 antibody was raised using the middle region of TUSC1 corresponding to a region with amino acids DSGREDEPGSPRALRARLEKLEAMYRRALLQLHLEQRGPRPSGDKEEQPL
- Top Product
- Discover our top product TUSC1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
TUSC1 Blocking Peptide, catalog no. 33R-2164, is also available for use as a blocking control in assays to test for specificity of this TUSC1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TUSC1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TUSC1 (Tumor Suppressor Candidate 1 (TUSC1))
- Andere Bezeichnung
- TUSC1 (TUSC1 Produkte)
- Hintergrund
- Tusc1 gene is located within the region of chromosome 9p that harbors tumor suppressor genes critical in carcinogenesis. It is an intronless gene which is downregulated in non-small-cell lung cancer and small-cell lung cancer cell lines, suggesting that it may play a role in lung tumorigenesis.
- Molekulargewicht
- 23 kDa (MW of target protein)
-