TUSC1 Antikörper (Middle Region)

Produktnummer ABIN631164

Produktdetails anti-TUSC1 Antikörper

Target: TUSC1 (Tumor Suppressor Candidate 1 (TUSC1))

Bindungsspezifität: Middle Region

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TUSC1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TUSC1 antibody was raised against the middle region of TUSC1

Aufreinigung: Affinity purified

Immunogen: TUSC1 antibody was raised using the middle region of TUSC1 corresponding to a region with amino acids DSGREDEPGSPRALRARLEKLEAMYRRALLQLHLEQRGPRPSGDKEEQPL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TUSC1 Blocking Peptide, catalog no. 33R-2164, is also available for use as a blocking control in assays to test for specificity of this TUSC1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TUSC1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TUSC1

Target: TUSC1 (Tumor Suppressor Candidate 1 (TUSC1))

Andere Bezeichnung: TUSC1 (TUSC1 Produkte)

Synonyme: TSG-9 antikoerper, TSG9 antikoerper, 2200001D17Rik antikoerper, tumor suppressor candidate 1 antikoerper, TUSC1 antikoerper, Tusc1 antikoerper

Hintergrund: Tusc1 gene is located within the region of chromosome 9p that harbors tumor suppressor genes critical in carcinogenesis. It is an intronless gene which is downregulated in non-small-cell lung cancer and small-cell lung cancer cell lines, suggesting that it may play a role in lung tumorigenesis.

Molekulargewicht: 23 kDa (MW of target protein)