GCHFR Antikörper (N-Term)
-
- Target Alle GCHFR Antikörper anzeigen
- GCHFR (GTP Cyclohydrolase I Feedback Regulator (GCHFR))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser GCHFR Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- GCHFR antibody was raised against the N terminal of GCHFR
- Aufreinigung
- Affinity purified
- Immunogen
- GCHFR antibody was raised using the N terminal of GCHFR corresponding to a region with amino acids MPYLLISTQIRMEVGPTMVGDEQSDPELMQHLGASKRRALGNNFYEYYVD
- Top Product
- Discover our top product GCHFR Primärantikörper
-
anti-GTP Cyclohydrolase I Feedback Regulator (GCHFR) antibody
Microarray verified GCHFR Reaktivität: Human, Maus IHC Wirt: Maus Monoclonal MAB689354 unconjugated
anti-GTP Cyclohydrolase I Feedback Regulator (GCHFR) (AA 11-55) antibodyGCHFR Reaktivität: Human ELISA, IHC, IF Wirt: Kaninchen Polyclonal unconjugated
anti-GTP Cyclohydrolase I Feedback Regulator (GCHFR) (AA 1-84) antibodyGCHFR Reaktivität: Human WB Wirt: Kaninchen Polyclonal unconjugated
anti-GTP Cyclohydrolase I Feedback Regulator (GCHFR) (AA 1-84) antibodyGCHFR Reaktivität: Human ELISA, IF Wirt: Maus Monoclonal 4G6 unconjugated
anti-GTP Cyclohydrolase I Feedback Regulator (GCHFR) antibodyMicroarray verified GCHFR Reaktivität: Human, Maus IHC Wirt: Maus Monoclonal MAB991590 unconjugated
anti-GTP Cyclohydrolase I Feedback Regulator (GCHFR) antibodyMicroarray verified GCHFR Reaktivität: Human, Maus IHC Wirt: Maus Monoclonal MAB694198 unconjugated
anti-GTP Cyclohydrolase I Feedback Regulator (GCHFR) antibodyMicroarray verified GCHFR Reaktivität: Human, Maus IHC Wirt: Maus Monoclonal MAB17092 unconjugated
anti-GTP Cyclohydrolase I Feedback Regulator (GCHFR) (AA 38-66), (C-Term) antibodyGCHFR Reaktivität: Human WB Wirt: Kaninchen Polyclonal RB39199 unconjugated
anti-GTP Cyclohydrolase I Feedback Regulator (GCHFR) (N-Term) antibodyGCHFR Reaktivität: Human, Maus, Pferd, Schwein WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
GCHFR Blocking Peptide, catalog no. 33R-6313, is also available for use as a blocking control in assays to test for specificity of this GCHFR antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GCHFR antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GCHFR (GTP Cyclohydrolase I Feedback Regulator (GCHFR))
- Andere Bezeichnung
- GCHFR (GCHFR Produkte)
- Synonyme
- GFRP antikoerper, HsT16933 antikoerper, P35 antikoerper, 2010323F13Rik antikoerper, GTP cyclohydrolase I feedback regulator antikoerper, GCHFR antikoerper, Gchfr antikoerper
- Hintergrund
- GTP cyclohydrolase I feedback regulatory protein binds to and mediates tetrahydrobiopterin inhibition of GTP cyclohydrolase I. The regulatory protein, GCHFR, consists of a homodimer. It is postulated that GCHFR may play a role in regulating phenylalanine metabolism in the liver and in the production of biogenic amine neurotransmitters and nitric oxide.
- Molekulargewicht
- 10 kDa (MW of target protein)
-
