GLUD1 Antikörper (N-Term)
-
- Target Alle GLUD1 Antikörper anzeigen
- GLUD1 (Glutamate Dehydrogenase 1 (GLUD1))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser GLUD1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- GLUD1 antibody was raised against the N terminal of GLUD1
- Aufreinigung
- Affinity purified
- Immunogen
- GLUD1 antibody was raised using the N terminal of GLUD1 corresponding to a region with amino acids EGFFDRGASIVEDKLVEDLRTRESEEQKRNRVRGILRIIKPCNHVLSLSF
- Top Product
- Discover our top product GLUD1 Primärantikörper
-
anti-Glutamate Dehydrogenase 1 (GLUD1) antibody
GLUD1 Reaktivität: Human, Maus, Ratte IHC, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Glutamate Dehydrogenase 1 (GLUD1) (AA 54-240) antibodyGLUD1 Reaktivität: Human WB, IHC, IP, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Glutamate Dehydrogenase 1 (GLUD1) antibodyGLUD1 Reaktivität: Human WB, IHC, IF Wirt: Kaninchen Monoclonal unconjugated
anti-Glutamate Dehydrogenase 1 (GLUD1) (N-Term) antibodyGLUD1 Reaktivität: Human, Maus, Ratte, Rind (Kuh), Pferd, Schwein, Zebrafisch (Danio rerio), Hund, Kaninchen, Schaf, Meerschweinchen WB, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Glutamate Dehydrogenase 1 (GLUD1) (AA 65-273) antibodyGLUD1 Reaktivität: Maus WB, IHC, IP, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Glutamate Dehydrogenase 1 (GLUD1) (N-Term) antibodyGLUD1 Reaktivität: Human, Maus, Ratte, Rind (Kuh), Pferd, Schwein, Zebrafisch (Danio rerio), Hund, Schaf, Saccharomyces cerevisiae WB, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Glutamate Dehydrogenase 1 (GLUD1) antibodyGLUD1 Reaktivität: Human WB, ELISA, IF, ICC, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Glutamate Dehydrogenase 1 (GLUD1) (AA 182-231) antibodyGLUD1 Reaktivität: Human, Maus, Ratte, Rind (Kuh), Pferd, Schwein, Zebrafisch (Danio rerio), Kaninchen, Huhn WB, IHC, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Glutamate Dehydrogenase 1 (GLUD1) (AA 93-107) antibodyGLUD1 Reaktivität: Human, Maus, Pferd, Schwein, Affe WB, IHC, ELISA, IHC (p) Wirt: Ziege Polyclonal unconjugated
anti-Glutamate Dehydrogenase 1 (GLUD1) (N-Term) antibodyGLUD1 Reaktivität: Human, Maus, Ratte WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
GLUD1 Blocking Peptide, catalog no. 33R-2427, is also available for use as a blocking control in assays to test for specificity of this GLUD1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GLUD1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GLUD1 (Glutamate Dehydrogenase 1 (GLUD1))
- Andere Bezeichnung
- GLUD1 (GLUD1 Produkte)
- Hintergrund
- L-glutamate dehydrogenase (EC 1.4.1.3) has a central role in nitrogen metabolism in plants and animals. Glutamate dehydrogenase is found in all organisms and catalyzes the oxidative deamination of 1-glutamate to 2-oxoglutarate. Glutamate, the main substrate of GLUD, is present in brain in concentrations higher than in other organs. In nervous tissue, GLUD appears to function in both the synthesis and the catabolism of glutamate and perhaps in ammonia detoxification.
- Molekulargewicht
- 56 kDa (MW of target protein)
- Pathways
- Positive Regulation of Peptide Hormone Secretion, Warburg Effekt
-
