GLUD1 Antikörper (N-Term)
-
- Target Alle GLUD1 Antikörper anzeigen
- GLUD1 (Glutamate Dehydrogenase 1 (GLUD1))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser GLUD1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- GLUD1 antibody was raised against the N terminal of GLUD1
- Aufreinigung
- Affinity purified
- Immunogen
- GLUD1 antibody was raised using the N terminal of GLUD1 corresponding to a region with amino acids EGFFDRGASIVEDKLVEDLRTRESEEQKRNRVRGILRIIKPCNHVLSLSF
- Top Product
- Discover our top product GLUD1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
GLUD1 Blocking Peptide, catalog no. 33R-2427, is also available for use as a blocking control in assays to test for specificity of this GLUD1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GLUD1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GLUD1 (Glutamate Dehydrogenase 1 (GLUD1))
- Andere Bezeichnung
- GLUD1 (GLUD1 Produkte)
- Synonyme
- GDH antikoerper, gdh1 antikoerper, GDH 1 antikoerper, glud1 antikoerper, GLUD1 antikoerper, cb719 antikoerper, wu:fb16e02 antikoerper, wu:fb58f12 antikoerper, wu:fe37f03 antikoerper, wu:fj43f02 antikoerper, zgc:192851 antikoerper, zgc:55630 antikoerper, GDH1 antikoerper, GLUD antikoerper, AI118167 antikoerper, Gdh-X antikoerper, Glud antikoerper, Gludl antikoerper, Ac2-281 antikoerper, Gdh1 antikoerper, Gludeha antikoerper, MRG-2 antikoerper, GLUTAMATE DECARBOXYLASE 1 antikoerper, GLUTAMATE DEHYDROGENASE 1 antikoerper, MRG7.13 antikoerper, MRG7_13 antikoerper, glutamate dehydrogenase 1 antikoerper, C2H1orf130 antikoerper, legdh1 antikoerper, cb622 antikoerper, wu:fc33g09 antikoerper, wu:fc66a10 antikoerper, zgc:77186 antikoerper, glutamate dehydrogenase 1 antikoerper, glutamate dehydrogenase 1 S homeolog antikoerper, glutamate dehydrogenase 1, mitochondrial antikoerper, glutamate dehydrogenase 1b antikoerper, glutamate dehydrogenase antikoerper, non-compact myelin associated protein antikoerper, glutamate dehydrogenase 1a antikoerper, GLUD1 antikoerper, GDH1 antikoerper, glud1 antikoerper, glud1.S antikoerper, LOC693461 antikoerper, glud1b antikoerper, Glud1 antikoerper, HACJB3_RS00320 antikoerper, LOC100587725 antikoerper, NCMAP antikoerper, gdh1 antikoerper, glud1a antikoerper
- Hintergrund
- L-glutamate dehydrogenase (EC 1.4.1.3) has a central role in nitrogen metabolism in plants and animals. Glutamate dehydrogenase is found in all organisms and catalyzes the oxidative deamination of 1-glutamate to 2-oxoglutarate. Glutamate, the main substrate of GLUD, is present in brain in concentrations higher than in other organs. In nervous tissue, GLUD appears to function in both the synthesis and the catabolism of glutamate and perhaps in ammonia detoxification.
- Molekulargewicht
- 56 kDa (MW of target protein)
- Pathways
- Positive Regulation of Peptide Hormone Secretion, Warburg Effekt
-