SULT2B1 Antikörper (C-Term)
-
- Target Alle SULT2B1 Antikörper anzeigen
- SULT2B1 (Sulfotransferase Family, Cytosolic, 2B, Member 1 (SULT2B1))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SULT2B1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- SULT2 B1 antibody was raised against the C terminal of SULT2 1
- Aufreinigung
- Affinity purified
- Immunogen
- SULT2 B1 antibody was raised using the C terminal of SULT2 1 corresponding to a region with amino acids NTMSNYTLLPPSLLDHRRGAFLRKGVCGDWKNHFTVAQSEAFDRAYRKQM
- Top Product
- Discover our top product SULT2B1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SULT2B1 Blocking Peptide, catalog no. 33R-6902, is also available for use as a blocking control in assays to test for specificity of this SULT2B1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SULT0 1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SULT2B1 (Sulfotransferase Family, Cytosolic, 2B, Member 1 (SULT2B1))
- Andere Bezeichnung
- SULT2B1 (SULT2B1 Produkte)
- Hintergrund
- Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. This gene sulfates dehydroepiandrosterone but not 4-nitrophenol, a typical substrate for the phenol and estrogen sulfotransferase subfamilies.
- Molekulargewicht
- 41 kDa (MW of target protein)
- Pathways
- Steroid Hormone Biosynthesis
-