SULT2B1 Antikörper (C-Term)

Produktnummer ABIN631179

Produktdetails anti-SULT2B1 Antikörper

Target: SULT2B1 (Sulfotransferase Family, Cytosolic, 2B, Member 1 (SULT2B1))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SULT2B1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SULT2 B1 antibody was raised against the C terminal of SULT2 1

Aufreinigung: Affinity purified

Immunogen: SULT2 B1 antibody was raised using the C terminal of SULT2 1 corresponding to a region with amino acids NTMSNYTLLPPSLLDHRRGAFLRKGVCGDWKNHFTVAQSEAFDRAYRKQM

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SULT2B1 Blocking Peptide, catalog no. 33R-6902, is also available for use as a blocking control in assays to test for specificity of this SULT2B1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SULT0 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SULT2B1

Target: SULT2B1 (Sulfotransferase Family, Cytosolic, 2B, Member 1 (SULT2B1))

Andere Bezeichnung: SULT2B1 (SULT2B1 Produkte)

Synonyme: HSST2 antikoerper, AI326997 antikoerper, BB173635 antikoerper, ST2B1 antikoerper, SULT2B antikoerper, SULT2B1 antikoerper, MGC79784 antikoerper, sulfotransferase family 2B member 1 antikoerper, sulfotransferase family, cytosolic, 2B, member 1 antikoerper, sulfotransferase family 2B member 1 L homeolog antikoerper, SULT2B1 antikoerper, Sult2b1 antikoerper, sult2b1 antikoerper, sult2b1.L antikoerper

Hintergrund: Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. This gene sulfates dehydroepiandrosterone but not 4-nitrophenol, a typical substrate for the phenol and estrogen sulfotransferase subfamilies.

Molekulargewicht: 41 kDa (MW of target protein)

Pathways: Steroid Hormone Biosynthesis