LONRF3 Antikörper (Middle Region)
-
- Target Alle LONRF3 Antikörper anzeigen
- LONRF3 (LON Peptidase N-terminal Domain and Ring Finger 3 (LONRF3))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser LONRF3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- LONRF3 antibody was raised against the middle region of LONRF3
- Aufreinigung
- Affinity purified
- Immunogen
- LONRF3 antibody was raised using the middle region of LONRF3 corresponding to a region with amino acids LEIRNVQFFADGRSVVDSIGKRRFRVLHQSQRDGYNTADIEYIEDQKVQG
- Top Product
- Discover our top product LONRF3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
LONRF3 Blocking Peptide, catalog no. 33R-4906, is also available for use as a blocking control in assays to test for specificity of this LONRF3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LONRF3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LONRF3 (LON Peptidase N-terminal Domain and Ring Finger 3 (LONRF3))
- Andere Bezeichnung
- LONRF3 (LONRF3 Produkte)
- Synonyme
- RNF127 antikoerper, 4932412G04Rik antikoerper, 5730439E01Rik antikoerper, A830039N02Rik antikoerper, AU023707 antikoerper, Rnf127 antikoerper, RGD1565451 antikoerper, LON peptidase N-terminal domain and ring finger 3 antikoerper, LONRF3 antikoerper, Lonrf3 antikoerper
- Hintergrund
- LONRF3 contains a RING finger domain, a motif present in a variety of functionally distinct proteins and known to be involved in protein-protein and protein-DNA interactions. Multiple alternatively spliced transcript variants have been suggested, but their full length natures are not clear.
- Molekulargewicht
- 84 kDa (MW of target protein)
-