SULT1A1 Antikörper (N-Term)

Produktnummer ABIN631191

Produktdetails anti-SULT1A1 Antikörper

Target: SULT1A1 (Sulfotransferase Family, Cytosolic, 1A, Phenol-Preferring, Member 1 (SULT1A1))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SULT1A1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SULT1 A1 antibody was raised against the N terminal of SULT1 1

Aufreinigung: Affinity purified

Immunogen: SULT1 A1 antibody was raised using the N terminal of SULT1 1 corresponding to a region with amino acids ELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SULT1A1 Blocking Peptide, catalog no. 33R-2553, is also available for use as a blocking control in assays to test for specificity of this SULT1A1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SULT0 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SULT1A1

Target: SULT1A1 (Sulfotransferase Family, Cytosolic, 1A, Phenol-Preferring, Member 1 (SULT1A1))

Andere Bezeichnung: SULT1A1 (SULT1A1 Produkte)

Synonyme: HAST1/HAST2 antikoerper, P-PST antikoerper, PST antikoerper, ST1A1 antikoerper, ST1A3 antikoerper, STP antikoerper, STP1 antikoerper, TSPST1 antikoerper, AI266890 antikoerper, Stp antikoerper, Stp1 antikoerper, ASTIV antikoerper, Mx-ST antikoerper, PST-1 antikoerper, St1a1 antikoerper, Stm antikoerper, Sult1a3 antikoerper, pst antikoerper, st1a3 antikoerper, stp antikoerper, stp1 antikoerper, tspst1 antikoerper, cSULT1A1 antikoerper, SULT1A2 antikoerper, SULT1A1 antikoerper, SIAT8-D antikoerper, ST8SiaIV antikoerper, Siat8d antikoerper, PST1 antikoerper, SIAT8D antikoerper, ST8SIA-IV antikoerper, sulfotransferase family 1A member 1 antikoerper, sulfotransferase family 1A, phenol-preferring, member 1 antikoerper, sulfotransferase family, cytosolic, 1A, phenol-preferring, member 1 antikoerper, sulfotransferase family 1A member 1 S homeolog antikoerper, sulfotransferase 1A1 antikoerper, ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 4 antikoerper, SULT1A1 antikoerper, Sult1a1 antikoerper, sult1a1 antikoerper, sult1a1.S antikoerper, LOC704658 antikoerper, LOC709318 antikoerper, St8sia4 antikoerper, ST8SIA4 antikoerper, LOC100064221 antikoerper

Hintergrund: Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. SULT1A1 is one of two phenol sulfotransferases with thermostable enzyme activity.

Molekulargewicht: 34 kDa (MW of target protein)