NGRN Antikörper (N-Term)

Produktnummer ABIN631192

Produktdetails anti-NGRN Antikörper

Target: NGRN (Neugrin, Neurite Outgrowth Associated (NGRN))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NGRN Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: NGRN antibody was raised against the N terminal of NGRN

Aufreinigung: Affinity purified

Immunogen: NGRN antibody was raised using the N terminal of NGRN corresponding to a region with amino acids MAVTLSLLLGGRVCAAVTRCGFATRGVAGPGPIGREPDPDSDWEPEEREL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NGRN Blocking Peptide, catalog no. 33R-5804, is also available for use as a blocking control in assays to test for specificity of this NGRN antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NGRN antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NGRN

Target: NGRN (Neugrin, Neurite Outgrowth Associated (NGRN))

Andere Bezeichnung: NGRN (NGRN Produkte)

Synonyme: Ngrn antikoerper, zgc:136784 antikoerper, dsc92 antikoerper, Neugrin antikoerper, DKFZp469B131 antikoerper, DSC92 antikoerper, AW552001 antikoerper, neugrin, neurite outgrowth associated antikoerper, ngrn antikoerper, NGRN antikoerper, Ngrn antikoerper

Hintergrund: NGRN may be involved in neuronal differentiation.

Molekulargewicht: 32 kDa (MW of target protein)