TINF2 Antikörper
-
- Target Alle TINF2 (TIN2) Antikörper anzeigen
- TINF2 (TIN2) (TERF1 Interacting Nuclear Factor 2 (TIN2))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TINF2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- TINF2 antibody was raised using a synthetic peptide corresponding to a region with amino acids SDEEENGQGEGKESLENYQKTKFDTLIPTLCEYLPPSGHGAIPVSSCDCR
- Top Product
- Discover our top product TIN2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
TINF2 Blocking Peptide, catalog no. 33R-8348, is also available for use as a blocking control in assays to test for specificity of this TINF2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TINF2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TINF2 (TIN2) (TERF1 Interacting Nuclear Factor 2 (TIN2))
- Andere Bezeichnung
- TINF2 (TIN2 Produkte)
- Synonyme
- DKCA3 antikoerper, TIN2 antikoerper, AW552114 antikoerper, D14Wsu146e antikoerper, Tin2 antikoerper, TERF1 interacting nuclear factor 2 antikoerper, Terf1 (TRF1)-interacting nuclear factor 2 antikoerper, TINF2 antikoerper, Tinf2 antikoerper
- Hintergrund
- TINF2 is a component of the shelterin complex (telosome) that is involved in the regulation of telomere length and protection. Shelterin associates with arrays of double-stranded TTAGGG repeats added by telomerase and protects chromosome ends, without its protective activity, telomeres are no longer hidden from the DNA damage surveillance and chromosome ends are inappropriately processed by DNA repair pathways. It plays a role in shelterin complex assembly.
- Molekulargewicht
- 50 kDa (MW of target protein)
- Pathways
- Zellzyklus, Telomere Maintenance, Regulation of Carbohydrate Metabolic Process
-