Rhotekin Antikörper (N-Term)

Produktnummer ABIN631197

Produktdetails anti-Rhotekin Antikörper

Target: Rhotekin (RTKN)

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Rhotekin Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Rhotekin antibody was raised against the N terminal of RTKN

Aufreinigung: Affinity purified

Immunogen: Rhotekin antibody was raised using the N terminal of RTKN corresponding to a region with amino acids DSGPPAERSPCRGRVCISDLRIPLMWKDTEYFKNKGDLHRWAVFLLLQLG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Rhotekin Blocking Peptide, catalog no. 33R-2163, is also available for use as a blocking control in assays to test for specificity of this Rhotekin antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RTKN antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Rhotekin

Target: Rhotekin (RTKN)

Andere Bezeichnung: Rhotekin (RTKN Produkte)

Synonyme: RTKN antikoerper, rhotekin antikoerper, RTKN antikoerper, rtkn antikoerper, Rtkn antikoerper

Hintergrund: RTKN mediates Rho signaling to activate NF-kappa-B and may confer increased resistance to apoptosis to cells in gastric tumorigenesis. RTKN may play a novel role in the organization of septin structures.

Molekulargewicht: 63 kDa (MW of target protein)