UBR1 Antikörper (N-Term)
-
- Target Alle UBR1 Antikörper anzeigen
- UBR1 (Ubiquitin Protein Ligase E3 Component N-Recognin 1 (UBR1))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser UBR1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- UBR1 antibody was raised against the N terminal of UBR1
- Aufreinigung
- Affinity purified
- Immunogen
- UBR1 antibody was raised using the N terminal of UBR1 corresponding to a region with amino acids YKQLQKEYISDDHDRSISITALSVQMFTVPTLARHLIEEQNVISVITETL
- Top Product
- Discover our top product UBR1 Primärantikörper
-
anti-Ubiquitin Protein Ligase E3 Component N-Recognin 1 (UBR1) (AA 2-100) antibody
UBR1 Reaktivität: Human WB, ELISA Wirt: Maus Monoclonal 2F5 unconjugated
anti-Ubiquitin Protein Ligase E3 Component N-Recognin 1 (UBR1) (AA 722-862) antibodyUBR1 Reaktivität: Human ELISA, IHC, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Ubiquitin Protein Ligase E3 Component N-Recognin 1 (UBR1) (AA 245-274), (N-Term) antibodyUBR1 Reaktivität: Maus WB Wirt: Kaninchen Polyclonal RB41861 unconjugated
anti-Ubiquitin Protein Ligase E3 Component N-Recognin 1 (UBR1) (AA 2-100) antibodyUBR1 Reaktivität: Human WB, ELISA Wirt: Maus Polyclonal unconjugated
anti-Ubiquitin Protein Ligase E3 Component N-Recognin 1 (UBR1) (AA 2-100) antibodyUBR1 Reaktivität: Human ELISA, IF Wirt: Maus Monoclonal 4G7 unconjugated
anti-Ubiquitin Protein Ligase E3 Component N-Recognin 1 (UBR1) (AA 801-900) antibodyUBR1 Reaktivität: Human, Maus WB, ELISA, IF (cc), IF (p), IHC (fro), IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Ubiquitin Protein Ligase E3 Component N-Recognin 1 (UBR1) (Internal Region) antibodyUBR1 Reaktivität: Human, Maus WB, ELISA, IF, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Ubiquitin Protein Ligase E3 Component N-Recognin 1 (UBR1) (AA 396-445) antibodyUBR1 Reaktivität: Human, Hund, Kaninchen, Affe, Meerschweinchen, Fledermaus WB Wirt: Kaninchen Polyclonal unconjugated
anti-Ubiquitin Protein Ligase E3 Component N-Recognin 1 (UBR1) (N-Term) antibodyUBR1 Reaktivität: Human, Maus, Ratte, Hund, Rind (Kuh), Pferd, Kaninchen, Meerschweinchen, Saccharomyces cerevisiae WB Wirt: Kaninchen Polyclonal unconjugated
anti-Ubiquitin Protein Ligase E3 Component N-Recognin 1 (UBR1) (Internal Region) antibodyUBR1 Reaktivität: Human, Maus WB, ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
UBR1 Blocking Peptide, catalog no. 33R-10155, is also available for use as a blocking control in assays to test for specificity of this UBR1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBR1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- UBR1 (Ubiquitin Protein Ligase E3 Component N-Recognin 1 (UBR1))
- Andere Bezeichnung
- UBR1 (UBR1 Produkte)
- Synonyme
- Dmel\\CG9086 antikoerper, Ubr1 antikoerper, UBR1 antikoerper, JBS antikoerper, AI504731 antikoerper, RGD1562326 antikoerper, Ubr1 ubiquitin ligase antikoerper, ubiquitin protein ligase E3 component n-recognin 1 antikoerper, E3 ubiquitin-protein ligase ubr-1 antikoerper, Ubr1 antikoerper, ubr1 antikoerper, UBR1 antikoerper, ubr-1 antikoerper
- Hintergrund
- UBR1 is an E3 ubiquitin-protein ligase which is a component of the N-end rule pathway. recognises and binds to proteins bearing specific N-terminal residues that are destabilizing according to the N-end rule, leading to their ubiquitination and subsequent degradation.
- Molekulargewicht
- 200 kDa (MW of target protein)
-
