AASDHPPT Antikörper (C-Term)
-
- Target Alle AASDHPPT Antikörper anzeigen
- AASDHPPT (Aminoadipate-Semialdehyde Dehydrogenase-phosphopantetheinyl Transferase (AASDHPPT))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser AASDHPPT Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- AASDHPPT antibody was raised against the C terminal of AASDHPPT
- Aufreinigung
- Affinity purified
- Immunogen
- AASDHPPT antibody was raised using the C terminal of AASDHPPT corresponding to a region with amino acids SRHQDVPSQDDSKPTQRQFTILNFNDLMSSAVPMTPEDPSFWDCFCFTEE
- Top Product
- Discover our top product AASDHPPT Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
AASDHPPT Blocking Peptide, catalog no. 33R-8756, is also available for use as a blocking control in assays to test for specificity of this AASDHPPT antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AASDHPPT antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- AASDHPPT (Aminoadipate-Semialdehyde Dehydrogenase-phosphopantetheinyl Transferase (AASDHPPT))
- Andere Bezeichnung
- AASDHPPT (AASDHPPT Produkte)
- Hintergrund
- AASDHPPT is similar to Saccharomyces cerevisiae LYS5, which is required for the activation of the alpha-aminoadipate dehydrogenase in the biosynthetic pathway of lysine. Yeast alpha-aminoadipate dehydrogenase converts alpha-biosynthetic-aminoadipate semialdehyde to alpha-aminoadipate. It has been suggested that defects in the human gene result in pipecolic acidemia.
- Molekulargewicht
- 36 kDa (MW of target protein)
-