COTL1 Antikörper
-
- Target Alle COTL1 Antikörper anzeigen
- COTL1 (Coactosin-Like Protein)
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser COTL1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- Coactosin-Like 1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MATKIDKEACRAAYNLVRDDGSAVIWVTFKYDGSTIVPGEQGAEYQHFIQ
- Top Product
- Discover our top product COTL1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Coactosin-Like 1 Blocking Peptide, catalog no. 33R-5779, is also available for use as a blocking control in assays to test for specificity of this Coactosin-Like 1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of COTL1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- COTL1 (Coactosin-Like Protein)
- Andere Bezeichnung
- Coactosin-Like 1 (COTL1 Produkte)
- Synonyme
- CLP antikoerper, 1810074P22Rik antikoerper, 2010004C08Rik antikoerper, Clp antikoerper, coactosin like F-actin binding protein 1 antikoerper, coactosin-like 1 (Dictyostelium) antikoerper, coactosin-like F-actin binding protein 1 antikoerper, COTL1 antikoerper, Cotl1 antikoerper
- Hintergrund
- This gene encodes one of the numerous actin-binding proteins which regulate the actin cytoskeleton. This protein binds F-actin, and also interacts with 5-lipoxygenase, which is the first committed enzyme in leukotriene biosynthesis.
- Molekulargewicht
- 16 kDa (MW of target protein)
-