MTIF3 Antikörper (Middle Region)
-
- Target Alle MTIF3 Antikörper anzeigen
- MTIF3 (Mitochondrial Translational Initiation Factor 3 (MTIF3))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser MTIF3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- MTIF3 antibody was raised against the middle region of MTIF3
- Aufreinigung
- Affinity purified
- Immunogen
- MTIF3 antibody was raised using the middle region of MTIF3 corresponding to a region with amino acids AVQGGKALMCVLRALSKNEEKAYKETQETQERDTLNKDHGNDKESNVLHQ
- Top Product
- Discover our top product MTIF3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
MTIF3 Blocking Peptide, catalog no. 33R-1612, is also available for use as a blocking control in assays to test for specificity of this MTIF3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MTIF3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MTIF3 (Mitochondrial Translational Initiation Factor 3 (MTIF3))
- Andere Bezeichnung
- MTIF3 (MTIF3 Produkte)
- Synonyme
- 2810012L14Rik antikoerper, AI414549 antikoerper, IF3mt antikoerper, fd12b09 antikoerper, wu:fd12b09 antikoerper, si:ch211-271b14.5 antikoerper, MGC145669 antikoerper, MGC145704 antikoerper, mitochondrial translational initiation factor 3 antikoerper, mitochondrial translational initiation factor 3 L homeolog antikoerper, Mtif3 antikoerper, MTIF3 antikoerper, mtif3 antikoerper, mtif3.L antikoerper
- Hintergrund
- IF-3 binds to the 28S ribosomal subunit and shifts the equilibrum between 55S ribosomes and their 39S and 28S subunits in favor of the free subunits, thus enhancing the availability of 28S subunits on which protein synthesis initiation begins.
- Molekulargewicht
- 32 kDa (MW of target protein)
- Pathways
- Ribonucleoprotein Complex Subunit Organization
-