PFN1 Antikörper (N-Term)
-
- Target Alle PFN1 Antikörper anzeigen
- PFN1 (Profilin 1 (PFN1))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PFN1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Profilin 1 antibody was raised against the N terminal of PFN1
- Aufreinigung
- Affinity purified
- Immunogen
- Profilin 1 antibody was raised using the N terminal of PFN1 corresponding to a region with amino acids AGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVL
- Top Product
- Discover our top product PFN1 Primärantikörper
-
anti-Profilin 1 (PFN1) (N-Term) antibody
PFN1 Reaktivität: Human, Maus, Ratte, Rind (Kuh), Meerschweinchen, Pferd, Zebrafisch (Danio rerio) WB Wirt: Kaninchen Polyclonal unconjugated
anti-Profilin 1 (PFN1) (C-Term) antibodyPFN1 Reaktivität: Human, Maus, Ratte WB, ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Profilin 1 (PFN1) (AA 108-140) antibodyPFN1 Reaktivität: Human, Maus, Ratte WB, FACS Wirt: Kaninchen Polyclonal RB55919 unconjugated
anti-Profilin 1 (PFN1) (AA 1-140) antibodyPFN1 Reaktivität: Human WB, ELISA Wirt: Maus Polyclonal unconjugated
anti-Profilin 1 (PFN1) antibodyPFN1 Reaktivität: Human WB, ICC, IF, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Profilin 1 (PFN1) (AA 87-120), (C-Term) antibodyPFN1 Reaktivität: Human WB Wirt: Kaninchen Polyclonal RB49649 unconjugated
anti-Profilin 1 (PFN1) (AA 1-139) antibodyPFN1 Reaktivität: Human WB, IHC, ICC, IP Wirt: Kaninchen Polyclonal unconjugated
anti-Profilin 1 (PFN1) (AA 1-140) antibodyPFN1 Reaktivität: Human WB Wirt: Kaninchen Polyclonal unconjugated
anti-Profilin 1 (PFN1) antibodyPFN1 Reaktivität: Human, Ratte, Affe, Hund WB, IHC, FACS, IF Wirt: Maus Monoclonal 1D5 unconjugated
anti-Profilin 1 (PFN1) antibodyPFN1 Reaktivität: Human, Ratte, Affe, Hund WB, IHC, FACS, IF Wirt: Maus Monoclonal 2D2 unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Profilin 1 Blocking Peptide, catalog no. 33R-1234, is also available for use as a blocking control in assays to test for specificity of this Profilin 1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PFN1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PFN1 (Profilin 1 (PFN1))
- Andere Bezeichnung
- Profilin 1 (PFN1 Produkte)
- Synonyme
- GmPRO1 antikoerper, GmPRO2 antikoerper, PRO1 antikoerper, Profilin-1 antikoerper, profilin-1 antikoerper, profilin antikoerper, MGC130883 antikoerper, Profilin1 antikoerper, XProfilin1 antikoerper, sb:cb813 antikoerper, wu:fa91a03 antikoerper, ALS18 antikoerper, Pfn antikoerper, F6F22.21 antikoerper, F6F22_21 antikoerper, PFN1 antikoerper, PROFILIN 1 antikoerper, profilin 1 antikoerper, profilin antikoerper, profilin 1 antikoerper, profilin 1 L homeolog antikoerper, profilin homolog 1 antikoerper, Profilin-1 antikoerper, PRO2 antikoerper, PFN1 antikoerper, pfn1.L antikoerper, pfn1 antikoerper, Pfn1 antikoerper, PRF1 antikoerper, prf1 antikoerper, pfn-1 antikoerper
- Hintergrund
- PFN1 is a ubiquitous actin monomer-binding protein belonging to the profilin family. It is thought to regulate actin polymerization in response to extracellular signals. Deletion of this gene is associated with Miller-Dieker syndrome.
- Molekulargewicht
- 15 kDa (MW of target protein)
- Pathways
- Regulation of Actin Filament Polymerization, Tube Formation, Maintenance of Protein Location
-
