GALT Antikörper (C-Term)

Produktnummer ABIN631216

Produktdetails anti-GALT Antikörper

Target: GALT (Galactose-1-Phosphate Uridylyltransferase (GALT))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GALT Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: GALT antibody was raised against the C terminal of GALT

Aufreinigung: Affinity purified

Immunogen: GALT antibody was raised using the C terminal of GALT corresponding to a region with amino acids LLRSATVRKFMVGYEMLAQAQRDLTPEQAAERLRALPEVHYHLGQKDRET

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GALT Blocking Peptide, catalog no. 33R-5189, is also available for use as a blocking control in assays to test for specificity of this GALT antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GALT antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GALT

Target: GALT (Galactose-1-Phosphate Uridylyltransferase (GALT))

Andere Bezeichnung: GALT (GALT Produkte)

Hintergrund: Galactose-1-phosphate uridyl transferase (GALT) catalyzes the second step of the Leloir pathway of galactose metabolism, namely the conversion of UDP-glucose + galactose-1-phosphate to glucose-1-phosphate + UDP-galactose. The absence of this enzyme results in classic galactosemia in humans and can be fatal in the newborn period if lactose is not removed from the diet.

Molekulargewicht: 43 kDa (MW of target protein)