Ketohexokinase Antikörper
-
- Target Alle Ketohexokinase (KHK) Antikörper anzeigen
- Ketohexokinase (KHK)
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Ketohexokinase Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Aufreinigung
- Affinity purified
- Immunogen
- KHK antibody was raised using a synthetic peptide corresponding to a region with amino acids FQSAEEALRGLYGRVRKGAVLVCAWAEEGADALGPDGKLLHSDAFPPPRV
- Top Product
- Discover our top product KHK Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
KHK Blocking Peptide, catalog no. 33R-3036, is also available for use as a blocking control in assays to test for specificity of this KHK antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KHK antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Ketohexokinase (KHK)
- Andere Bezeichnung
- KHK (KHK Produkte)
- Synonyme
- wu:fj68h03 antikoerper, zgc:92219 antikoerper, zgc:92626 antikoerper, KHK antikoerper, khk antikoerper, KETHPRO antikoerper, ketohexokinase antikoerper, Ketohexokinase antikoerper, KHK antikoerper, khk antikoerper, Hhal_0921 antikoerper, AaeL_AAEL006316 antikoerper, Nwat_0240 antikoerper, Khk antikoerper
- Hintergrund
- KHK is a ketohexokinase that catalyzes conversion of fructose to fructose-1-phosphate. The product of this gene is the first enzyme with a specialized pathway that catabolizes dietary fructose.KHK encodes the gene ketohexokinase that catalyzes conversion of fructose to fructose-1-phosphate. The splice variant presented encodes the highly active form found in liver, renal cortex, and small intestine, while the alternate variant encodes the lower activity form found in most other tissues.
- Molekulargewicht
- 33 kDa (MW of target protein)
-